Recombinant Human KREMEN1 Protein, GST-tagged
| Cat.No. : | KREMEN1-4883H |
| Product Overview : | Human KREMEN1 partial ORF ( NP_114434, 310 a.a. - 391 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein is a component of a membrane complex that modulates canonical WNT signaling through lipoprotein receptor-related protein 6 (LRP6). It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq |
| Molecular Mass : | 34.76 kDa |
| AA Sequence : | INQAQGFAVLYQAVKEELPQERPAVNQTVAEVITEQANLSVSAARSSKVLYVITTSPSHPPQTVPGSNSWAPPMGAGSHRVE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KREMEN1 kringle containing transmembrane protein 1 [ Homo sapiens ] |
| Official Symbol | KREMEN1 |
| Synonyms | KREMEN1; kringle containing transmembrane protein 1; KREMEN, kringle containing transmembrane protein; kremen protein 1; KRM1; dickkopf receptor; kringle-coding gene marking the eye and the nose; kringle domain-containing transmembrane protein 1; kringle-containing protein marking the eye and the nose; KREMEN; FLJ31863; |
| Gene ID | 83999 |
| mRNA Refseq | NM_001039570 |
| Protein Refseq | NP_001034659 |
| MIM | 609898 |
| UniProt ID | Q96MU8 |
| ◆ Recombinant Proteins | ||
| KREMEN1-5208H | Recombinant Human KREMEN1 Protein (Lys157-Gly390), N-His tagged | +Inquiry |
| KREMEN1-4906M | Recombinant Mouse KREMEN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KREMEN1-4883H | Recombinant Human KREMEN1 Protein, GST-tagged | +Inquiry |
| KREMEN1-2847H | Recombinant Human KREMEN1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KREMEN1-327H | Recombinant Human KREMEN1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KREMEN1 Products
Required fields are marked with *
My Review for All KREMEN1 Products
Required fields are marked with *
