Recombinant Human KREMEN2 Protein, GST-tagged
| Cat.No. : | KREMEN2-4882H |
| Product Overview : | Human KREMEN2 full-length ORF ( NP_078783.1, 1 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a high-affinity dickkopf homolog 1 (DKK1) transmembrane receptor that functionally cooperates with DKK1 to block wingless (WNT)/beta-catenin signaling. The encoded protein forms a ternary membrane complex with DKK1 and the WNT receptor lipoprotein receptor-related protein 6 (LRP6), and induces rapid endocytosis and removal of LRP6 from the plasma membrane. It contains extracellular kringle, WSC, and CUB domains. Alternatively spliced transcript variants encoding distinct isoforms have been observed for this gene. [provided by RefSeq |
| Molecular Mass : | 70.8 kDa |
| AA Sequence : | MGTQALQGFLFLLFLPLLQPRGASAGSLHSPGLSECFQVNGADYRGHQNRTGPRGAGRPCLFWDQTQQHSYSSASDPHGRWGLGAHNFCRNPDGDVQPWCYVAETEEGIYWRYCDIPSCHMPGYLGCFVDSGAPPALSGPSGTSTKLTVQVCLRFCRMKGYQLAGVEAGYACFCGSESDLARGRLAPATDCDQICFGHPGQLCGGDGRLGVYEVSVGSCQGNWTAPQGVIYSPDFPDEYGPDRNCSWALGPPGAALELTFRLFELADPRDRLELRDAASGSLLRAFDGARPPPSGPLRLGTAALLLTFRSDARGHAQGFALTYRGLQDAAEDPEAPEGSAQTPAAPLDGANVSCSPRPGAPPAAIGGAVCWLREKGPRRWGLPGAPGEAGLCGTNSPEGWPCPAPPGTPRLRVLPRATGL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KREMEN2 kringle containing transmembrane protein 2 [ Homo sapiens ] |
| Official Symbol | KREMEN2 |
| Synonyms | KREMEN2; kringle containing transmembrane protein 2; kremen protein 2; KRM2; MGC10791; dickkopf receptor 2; kringle domain-containing transmembrane protein 2; kringle-containing protein marking the eye and the nose; MGC16709; |
| Gene ID | 79412 |
| mRNA Refseq | NM_001253725 |
| Protein Refseq | NP_001240654 |
| MIM | 609899 |
| UniProt ID | Q8NCW0 |
| ◆ Recombinant Proteins | ||
| KREMEN2-2131H | Recombinant Human KREMEN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| KREMEN2-1674C | Recombinant Cynomolgus KREMEN2 protein, His-tagged | +Inquiry |
| KREMEN2-1920H | Recombinant Human KREMEN2 protein, His-tagged | +Inquiry |
| KREMEN2-5880HF | Recombinant Full Length Human KREMEN2 Protein, GST-tagged | +Inquiry |
| KREMEN2-4882H | Recombinant Human KREMEN2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KREMEN2-4883HCL | Recombinant Human KREMEN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KREMEN2 Products
Required fields are marked with *
My Review for All KREMEN2 Products
Required fields are marked with *
