Recombinant Human KRT25 Protein, GST-tagged

Cat.No. : KRT25-4859H
Product Overview : Human KRT25 full-length ORF ( AAI46489.1, 1 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. [provided by RefSeq
Molecular Mass : 76.45 kDa
AA Sequence : MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGGGNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KRT25 keratin 25 [ Homo sapiens (human) ]
Official Symbol KRT25
Synonyms KRT25; keratin 25; ARWH3; KRT25A; KRT24IRS1; keratin, type I cytoskeletal 25; CK-25; K25; K25A; cytokeratin-25; keratin 25, type I; keratin-25A; type I inner root sheath specific keratin 25 irs1; type I inner root sheath-specific keratin-K25irs1
Gene ID 147183
mRNA Refseq NM_181534
Protein Refseq NP_853512
MIM 616646
UniProt ID Q7Z3Z0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KRT25 Products

Required fields are marked with *

My Review for All KRT25 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon