Recombinant Human KRT25 Protein, GST-tagged
| Cat.No. : | KRT25-4859H |
| Product Overview : | Human KRT25 full-length ORF ( AAI46489.1, 1 a.a. - 450 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the type I (acidic) keratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. The type I keratin genes are clustered in a region of chromosome 17q12-q21. [provided by RefSeq |
| Molecular Mass : | 76.45 kDa |
| AA Sequence : | MSLRLSSASRRSCPRPTTGSLRLYGGGTSFGTGNSCGISGIGSGFSSAFGGSSSGGNTGGGNPCAGFTVNERGLLSGNEKVTMQNLNDRLASYLDSVHALEEANADLEQKIKGWYEKFGPGSCRGLDHDYSRYFPIIDDLKNQIIASTTSNANAVLQIDNARLTADDFRLKYENELALHQSVEADVNGLRRVLDEITLCRTDLEIQYETLSEEMTYLKKNHKEEMQVLQCAAGGNVNVEMNAAPGVDLTVLLNNMRAEYEALAEQNRRDAEAWFNEKSASLQQQISEDVGATTSARNELTEMKRTLQTLEIELQSLLATKHSLECSLTETESNYCAQLAQIQAQIGALEEQLHQVRTETEGQKLEYEQLLDIKLHLEKEIETYCLLIGGDDGACKSGGYKSKDYGSGNVGSQVKDPAKAIVVKKVLEEVDQRSKILTTRLHSLEEKSQSN |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRT25 keratin 25 [ Homo sapiens (human) ] |
| Official Symbol | KRT25 |
| Synonyms | KRT25; keratin 25; ARWH3; KRT25A; KRT24IRS1; keratin, type I cytoskeletal 25; CK-25; K25; K25A; cytokeratin-25; keratin 25, type I; keratin-25A; type I inner root sheath specific keratin 25 irs1; type I inner root sheath-specific keratin-K25irs1 |
| Gene ID | 147183 |
| mRNA Refseq | NM_181534 |
| Protein Refseq | NP_853512 |
| MIM | 616646 |
| UniProt ID | Q7Z3Z0 |
| ◆ Recombinant Proteins | ||
| Krt25-1599M | Recombinant Mouse Krt25 protein, His & T7-tagged | +Inquiry |
| KRT25-3320R | Recombinant Rat KRT25 Protein | +Inquiry |
| KRT25-4919M | Recombinant Mouse KRT25 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRT25-5973HF | Recombinant Full Length Human KRT25 Protein, GST-tagged | +Inquiry |
| KRT25-4859H | Recombinant Human KRT25 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT25 Products
Required fields are marked with *
My Review for All KRT25 Products
Required fields are marked with *
