Recombinant Human KRT3 protein(201-530 aa), C-His-tagged
Cat.No. : | KRT3-2641H |
Product Overview : | Recombinant Human KRT3 protein(P12035)(201-530 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 201-530 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | QIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSST |
Gene Name | KRT3 keratin 3 [ Homo sapiens ] |
Official Symbol | KRT3 |
Gene ID | 3850 |
mRNA Refseq | NM_057088 |
Protein Refseq | NP_476429 |
MIM | 148043 |
UniProt ID | P12035 |
◆ Recombinant Proteins | ||
KRT3-6017HF | Recombinant Full Length Human KRT3 Protein, GST-tagged | +Inquiry |
KRT3-2640H | Recombinant Human KRT3 protein(181-510 aa), C-His-tagged | +Inquiry |
KRT3-2641H | Recombinant Human KRT3 protein(201-530 aa), C-His-tagged | +Inquiry |
KRT3-879H | Recombinant Human KRT3 Protein, His-tagged | +Inquiry |
KRT3-4856H | Recombinant Human KRT3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT3 Products
Required fields are marked with *
My Review for All KRT3 Products
Required fields are marked with *