Recombinant Human KRT3 Protein, GST-tagged
| Cat.No. : | KRT3-4856H |
| Product Overview : | Human KRT3 full-length ORF (AAI56126.1, 1 a.a. - 628 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the keratin gene family. The type II cytokeratins consist of basic or neutral proteins which are arranged in pairs of heterotypic keratin chains coexpressed during differentiation of simple and stratified epithelial tissues. This type II cytokeratin is specifically expressed in the corneal epithelium with family member KRT12 and mutations in these genes have been associated with Meesmanns Corneal Dystrophy. The type II cytokeratins are clustered in a region of chromosome 12q12-q13. [provided by RefSeq |
| Molecular Mass : | 95.5 kDa |
| AA Sequence : | MSRQASKTSGGGSQGFSGRSAVVSGSSRMSCVAHSGGAGGGAYGFRSGAGGFGSRSLYNLGGNKSISISVAAGGSRAGGFGGGRSSCAFAGGYGGGFGSGYGGGFGGGFGGGRGMGGGFGGAGGFGGAGGFGGAGGFGGPGGFGGSGGFGGPGSLGSPGGFGPGGFPGGIQEVTINQSLLQPLNVEIDPQIGQVKAQEREQIKTLNNKFASFIDKVRFLEQQNKVLETKWNLLQQQGTSSISGTNNLEPLFENHINYLRSYLDNILGERGRLDSELKNMEDLVEDFKKKYEDEINKRTAAENEFVTLKKDVDSAYMNKVELQAKVDALIDEIDFLRTLYDAELSQMQSHISDTSVVLSMDNNRSLDLDSIIAEVRAQYEDIAQRSKAEAEALYQTKLGELQTTAGRHGDDLRNTKSEIIELNRMIQRLRAEIEGVKKQNANLQTAIAEAEQHGEMALKDANAKLQELQAALQQAKDDLARLLRDYQELMNVKLALDVEIATYRKLLEGEEYRMSGECPSAVSISVVSSSTTSASAGGYGGGYGGGMGGGLGGGFSAGGGSGSGFGRGGGGGIGGGFGGGSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KRT3 keratin 3 [ Homo sapiens (human) ] |
| Official Symbol | KRT3 |
| Synonyms | KRT3; keratin 3; K3; CK3; keratin, type II cytoskeletal 3; 65 kDa cytokeratin; CK-3; cytokeratin 3; keratin 3, type II; type-II keratin Kb3 |
| Gene ID | 3850 |
| mRNA Refseq | NM_057088 |
| Protein Refseq | NP_476429 |
| MIM | 148043 |
| UniProt ID | P12035 |
| ◆ Recombinant Proteins | ||
| KRT3-879H | Recombinant Human KRT3 Protein, His-tagged | +Inquiry |
| KRT3-2640H | Recombinant Human KRT3 protein(181-510 aa), C-His-tagged | +Inquiry |
| KRT3-6017HF | Recombinant Full Length Human KRT3 Protein, GST-tagged | +Inquiry |
| KRT3-3246H | Recombinant Human KRT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KRT3-254H | Recombinant Human KRT3 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT3 Products
Required fields are marked with *
My Review for All KRT3 Products
Required fields are marked with *
