Recombinant Human KRT9 Protein, GST-tagged
Cat.No. : | KRT9-4829H |
Product Overview : | Human KRT9 full-length ORF (AAI67813.1, 1 a.a. - 623 a.a.) recombinant protein with GST tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the type I keratin 9, an intermediate filament chain expressed only in the terminally differentiated epidermis of palms and soles. Mutations in this gene cause epidermolytic palmoplantar keratoderma. [provided by RefSeq |
Molecular Mass : | 95 kDa |
AA Sequence : | MSCRQFSSSYLSRSGGGGGGGLGSGGSIRSSYSRFSSSGGGGGGGRFSSSSGYGGGSSRVCGRGGGGSFGYSYGGGSGGGFSASSLGGGFGGGSRGFGGASGGGYSSSGGFGGGFGGGSGGGFGGGYGSGFGGFGGFGGGAGGGDGGILTANEKSTMQELNSRLASYLDKVQALEEANNDLENKIQDWYDKKGPAAIQKNYSPYYNTIDDLKDQIVDLTVGNNKTLLDIDNTRMTLDDFRIKFEMEQNLRQGVDADINGLRQVLDNLTMEKSDLEMQYETLQEELMALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTKTLNDMRQEYEQLIAKNRKDIENQYETQITQIEHEVSSSGQEVQSSAKEVTQLRHGVQELEIELQSQLSKKAALEKSLEDTKNRYCGQLQMIQEQISNLEAQITDVRQEIECQNQEYSLLLSIKMRLEKEIETYHNLLEGGQEDFESSGAGKIGLGGRGGSGGSYGRGSRGGSGGSYGGGGSGGGYGGGSGSRGGSGGSYGGGSGSGGGSGGGYGGGSGGGHSGGSGGGHSGGSGGNYGGGSGSGGGSGGGYGGGSGSRGGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGKSSHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | KRT9 keratin 9 [ Homo sapiens ] |
Official Symbol | KRT9 |
Synonyms | KRT9; keratin 9; keratin, type I cytoskeletal 9; CK 9; cytokeratin 9; epidermolytic palmoplantar keratoderma; EPPK; K9; type I cytoskeletal 9; keratin-9; cytokeratin-9; CK-9; |
Gene ID | 3857 |
mRNA Refseq | NM_000226 |
Protein Refseq | NP_000217 |
MIM | 607606 |
UniProt ID | P35527 |
◆ Recombinant Proteins | ||
KRT9-5791HF | Recombinant Full Length Human KRT9 Protein, GST-tagged | +Inquiry |
KRT9-2990R | Recombinant Rat KRT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT9-8863M | Recombinant Mouse KRT9 Protein | +Inquiry |
KRT9-4947M | Recombinant Mouse KRT9 Protein, His (Fc)-Avi-tagged | +Inquiry |
KRT9-2782H | Recombinant Human KRT9 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KRT9 Products
Required fields are marked with *
My Review for All KRT9 Products
Required fields are marked with *