Recombinant Human KSR1 Protein (404-598 aa), His-tagged

• Cat.No.: KSR1-2646H
• Product Overview: Recombinant Human KSR1 Protein (404-598 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 404-598 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.0 kDa
• AA Sequence: TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ
• Purity: > 85% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA will be sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: KSR1 kinase suppressor of ras 1 [ Homo sapiens ]
• Official Symbol: KSR1
• Synonyms: KSR1; kinase suppressor of ras 1; kinase suppressor of Ras 1; RSU2; KSR
• Gene ID: 8844
• mRNA Refseq: NM_014238
• Protein Refseq: NP_055053
• MIM: 601132
• UniProt ID: Q8IVT5