Recombinant Human KSR1 Protein (404-598 aa), His-tagged
| Cat.No. : | KSR1-2646H |
| Product Overview : | Recombinant Human KSR1 Protein (404-598 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 404-598 aa |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 25.0 kDa |
| AA Sequence : | TESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQ |
| Purity : | > 85% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
| Gene Name | KSR1 kinase suppressor of ras 1 [ Homo sapiens ] |
| Official Symbol | KSR1 |
| Synonyms | KSR1; kinase suppressor of ras 1; kinase suppressor of Ras 1; RSU2; KSR; |
| Gene ID | 8844 |
| mRNA Refseq | NM_014238 |
| Protein Refseq | NP_055053 |
| MIM | 601132 |
| UniProt ID | Q8IVT5 |
| ◆ Recombinant Proteins | ||
| KSR1-008H | Recombinant Human kinase suppressor of ras 1 Protein, His tagged | +Inquiry |
| KSR1-34H | Active Recombinant Human KSR1, GST-tagged | +Inquiry |
| KSR1-4966M | Recombinant Mouse KSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KSR1-62H | Recombinant Human KSR1 (A635F), GST-tagged | +Inquiry |
| KSR1-1422H | Active Recombinant Human KSR1 protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KSR1-485HKCL | Human KSR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KSR1 Products
Required fields are marked with *
My Review for All KSR1 Products
Required fields are marked with *
