Recombinant Human KSR1 Protein, GST-tagged

• Cat.No.: KSR1-4795H
• Product Overview: Human KSR partial ORF ( XP_290793, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: KSR1 (Kinase Suppressor Of Ras 1) is a Protein Coding gene. Among its related pathways are RET signaling and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is KSR2.
• Molecular Mass: 36.63 kDa
• AA Sequence: LDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: KSR1 kinase suppressor of ras 1 [ Homo sapiens ]
• Official Symbol: KSR1
• Synonyms: KSR1; kinase suppressor of ras 1; kinase suppressor of ras , KSR; kinase suppressor of Ras 1; RSU2; KSR
• Gene ID: 8844
• mRNA Refseq: NM_014238
• Protein Refseq: NP_055053
• MIM: 601132
• UniProt ID: Q8IVT5