Recombinant Human KSR1 Protein, GST-tagged

Cat.No. : KSR1-4795H
Product Overview : Human KSR partial ORF ( XP_290793, 301 a.a. - 400 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : KSR1 (Kinase Suppressor Of Ras 1) is a Protein Coding gene. Among its related pathways are RET signaling and MAPK Signaling: Mitogen Stimulation Pathway. GO annotations related to this gene include transferase activity, transferring phosphorus-containing groups and protein tyrosine kinase activity. An important paralog of this gene is KSR2.
Molecular Mass : 36.63 kDa
AA Sequence : LDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKP
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KSR1 kinase suppressor of ras 1 [ Homo sapiens ]
Official Symbol KSR1
Synonyms KSR1; kinase suppressor of ras 1; kinase suppressor of ras , KSR; kinase suppressor of Ras 1; RSU2; KSR;
Gene ID 8844
mRNA Refseq NM_014238
Protein Refseq NP_055053
MIM 601132
UniProt ID Q8IVT5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KSR1 Products

Required fields are marked with *

My Review for All KSR1 Products

Required fields are marked with *

0
cart-icon
0
compare icon