Recombinant Human KSR1 Protein, GST-tagged
| Cat.No. : | KSR1-4796H |
| Product Overview : | Human KSR1 full-length ORF ( AAI67812.1, 1 a.a. - 762 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Enables 14-3-3 protein binding activity; ATP binding activity; and protein C-terminus binding activity. Involved in positive regulation of MAPK cascade. Located in endoplasmic reticulum and membrane. Part of protein-containing complex. Implicated in breast adenocarcinoma. Biomarker of breast cancer. |
| Molecular Mass : | 83.9 kDa |
| AA Sequence : | MNEAKVKETLRRCGASGDECGRLQYALTCLRKVTGLGGEHKEDSSWSSLDARRESGSGPSTDTLSAASLPWPPGSSQLGRAGNSAQGPRSISVSALPASDSPTPSFSEGLSDTCIPLHASGRLTPRALHSFITPPTTPQLRRHTKLKPPRTPPPPSRKVFQLLPSFPTLTRSKSHESQLGNRIDDVSSMRFDLSHGSPQMVRRDIGLSVTHRFSTKSWLSQVCHVCQKSMIFGVKCKHCRLKCHNKCTKEAPACRISFLPLTRLRRTESVPSDINNPVDRAAEPHFGTLPKALTKKEHPPAMNHLDSSSNPSSTTSSTPSSPAPFPTSSNPSSATTPPNPSPGQRDSRFNFPAAYFIHHRQQFIFPVPSAGHCWKCLLIAESLKENAFNISAFAHAAPLPEAADGTRLDDQPKADVLEAHEAEAEEPEAGKSEAEDDEDEVDDLPSSRRPWRGPISRKASQTSVYLQEWDIPFEQVELGEPIGQGRWGRVHRGRWHGEVAIRLLEMDGHNQDHLKLFKKEVMNYRQTRHENVVLFMGACMNPPHLAIITSFCKGRTLHSFVRDPKTSLDINKTRQIAQEIIKGMGYLHAKGIVHKDLKSKNVFYDNGKVVITDFGLFGISGVVREGRRENQLKLSHDWLCYLAPEIVREMTPGKDEDQLPFSKAADVYAFGTVWYELQARDWPLKNQAAEASIWQIGSGEGMKRVLTSVSLGKEVSEILSACWAFDLQERPSFSLLMDMLEKLPKLNRRLSHPGHFWKSAEL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KSR1 kinase suppressor of ras 1 [ Homo sapiens (human) ] |
| Official Symbol | KSR1 |
| Synonyms | KSR1; kinase suppressor of ras 1; KSR; RSU2; kinase suppressor of Ras 1; EC 2.7.11.1 |
| Gene ID | 8844 |
| mRNA Refseq | https://www.ncbi.nlm.nih.gov/nuccore/NM_014238.2 |
| Protein Refseq | https://www.ncbi.nlm.nih.gov/protein/NP_055053.1 |
| MIM | https://omim.org/entry/601132 |
| UniProt ID | https://www.uniprot.org/uniprotkb/Q8IVT5/entry |
| ◆ Recombinant Proteins | ||
| KSR1-008H | Recombinant Human kinase suppressor of ras 1 Protein, His tagged | +Inquiry |
| KSR1-4966M | Recombinant Mouse KSR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| KSR1-34H | Active Recombinant Human KSR1, GST-tagged | +Inquiry |
| KSR1-62H | Recombinant Human KSR1 (A635F), GST-tagged | +Inquiry |
| KSR1-63H | Recombinant Human KSR1 (L639F), GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KSR1-485HKCL | Human KSR1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KSR1 Products
Required fields are marked with *
My Review for All KSR1 Products
Required fields are marked with *
