Recombinant Human KTN1, His-tagged
Cat.No. : | KTN1-27880TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1051-1300 of Human Kinectin 1 Isoform 2 with an N terminal His tag; Predicted MWt 30 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1051-1300 a.a. |
Description : | This gene encodes an integral membrane protein that is a member of the kinectin protein family. The encoded protein is primarily localized to the endoplasmic reticulum membrane. This protein binds kinesin and may be involved in intracellular organelle motility. This protein also binds translation elongation factor-delta and may be involved in may be involved in the assembly of the elongation factor-1 complex. Alternate splicing results in multiple transcript variants of this gene. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 52 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | FPKVSVPSNLSYGEWLHGFEKKAKECMAGTSGSEEVKVLE HKLKEADEMHTLLQLECEKYKSVLAETEGILQKLQRSV EQEENKWKVKVDESHKTIKQMQSSFTSSEQELERLRSE NKDIENLRREREHLEMELEKAEMERSTYVTEVRELKAQ LNETLTKLRTEQNERQKVAGDLHKAQQSLELIQSKIVKAA GDTTVIENSDVSPETESSEKETMSVSLNQTVTQLQQLL QAVNQQLTKEKEHYQVLE |
Gene Name | KTN1 kinectin 1 (kinesin receptor) [ Homo sapiens ] |
Official Symbol | KTN1 |
Synonyms | KTN1; kinectin 1 (kinesin receptor); kinectin; CG1; KIAA0004; |
Gene ID | 3895 |
mRNA Refseq | NM_001079521 |
Protein Refseq | NP_001072989 |
MIM | 600381 |
Uniprot ID | Q86UP2 |
Chromosome Location | 14q22.1 |
Pathway | TNF-alpha/NF-kB Signaling Pathway, organism-specific biosystem; |
Function | molecular_function; receptor activity; |
◆ Recombinant Proteins | ||
KTN1-278H | Recombinant Human KTN1 protein, His-tagged | +Inquiry |
KTN1-10434Z | Recombinant Zebrafish KTN1 | +Inquiry |
Ktn1-7884R | Recombinant Rat Ktn1 protein, His & T7-tagged | +Inquiry |
Ktn1-1724M | Recombinant Mouse Ktn1 Protein, His-tagged | +Inquiry |
KTN1-4398H | Recombinant Human KTN1 Protein (Glu1104-Glu1357), N-His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KTN1 Products
Required fields are marked with *
My Review for All KTN1 Products
Required fields are marked with *
0
Inquiry Basket