Recombinant Human KU-MEL-3 Protein, GST-tagged
| Cat.No. : | KU-MEL-3-4787H |
| Product Overview : | Human KU-MEL-3 full-length ORF ( ADR83454.1, 1 a.a. - 58 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1-58 a.a. |
| Description : | KU-MEL-3 (Uncharacterized LOC497048) is an RNA Gene, and is affiliated with the ncRNA class. |
| Molecular Mass : | 6.4 kDa |
| AA Sequence : | MLPRTPRPDLILLQLLPAGLRPPDLQAPYPPAGLCSTLIFVPCFQSCQASGSLSLTSP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | KU-MEL-3 uncharacterized LOC497048 [ Homo sapiens (human) ] |
| Official Symbol | KU-MEL-3 |
| Synonyms | KU-MEL-3; uncharacterized LOC497048; |
| Gene ID | 497048 |
| ◆ Recombinant Proteins | ||
| KU-MEL-3-4787H | Recombinant Human KU-MEL-3 Protein, GST-tagged | +Inquiry |
| KU-MEL-3-5882HF | Recombinant Full Length Human KU-MEL-3 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KU-MEL-3 Products
Required fields are marked with *
My Review for All KU-MEL-3 Products
Required fields are marked with *
