Recombinant Human KYAT1 Protein, His tagged

• Cat.No.: KYAT1-001H
• Product Overview: Recombinant Human KYAT1 Protein with His tag was expressed in Insect Cells.

Specification

• Species: Human
• Source: Insect Cells
• Tag: His
• Protein Length: 182-422 aa
• Description: This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.
• AASequence: MTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELHHHHHHHH
• Molecular Mass: 29 kDa
• Endotoxin: < 1 EU/μg of protein (determined by LAL method)
• Purity: > 80% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
• Concentration: 0.76 mg/mL by BCA

Gene Information

• Gene Name: KYAT1 kynurenine aminotransferase 1 [ Homo sapiens (human) ]
• Official Symbol: KYAT1
• Synonyms: KYAT1; kynurenine aminotransferase 1; GTK; KAT1; KATI; CCBL1; kynurenine--oxoglutarate transaminase 1; beta-lysase, kidney; cysteine conjugate beta lyase 1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); cysteine-S-conjugate beta-lyase; glutamine transaminase K; glutamine--phenylpyruvate transaminase; glutamine-phenylpyruvate aminotransferase; kyneurenine aminotransferase; kynurenine aminotransferase I; kynurenine--oxoglutarate transaminase I; EC 2.6.1.64; EC 2.6.1.7; EC 4.4.1.13
• Gene ID: 883
• mRNA Refseq: NM_004059
• Protein Refseq: NP_004050
• MIM: 600547
• UniProt ID: Q16773