Recombinant Human KYAT1 Protein, His tagged

Cat.No. : KYAT1-001H
Product Overview : Recombinant Human KYAT1 Protein with His tag was expressed in Insect Cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Insect Cells
Tag : His
Protein Length : 182-422 aa
Description : This gene encodes a cytosolic enzyme that is responsible for the metabolism of cysteine conjugates of certain halogenated alkenes and alkanes. This metabolism can form reactive metabolites leading to nephrotoxicity and neurotoxicity. Increased levels of this enzyme have been linked to schizophrenia. Multiple transcript variants that encode different isoforms have been identified for this gene.
AASequence : MTPNNPLGKVFSREELELVASLCQQHDVVCITDEVYQWMVYDGHQHISIASLPGMWERTLTIGSAGKTFSATGWKVGWVLGPDHIMKHLRTVHQNSVFHCPTQSQAAVAESFEREQLLFRQPSSYFVQFPQAMQRCRDHMIRSLQSVGLKPIIPQGSYFLITDISDFKRKMPDLPGAVDEPYDRRFVKWMIKNKGLVAIPVSIFYSVPHQKHFDHYIRFCFVKDEATLQAMDEKLRKWKVELHHHHHHHH
Molecular Mass : 29 kDa
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 80% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose
Concentration : 0.76 mg/mL by BCA
Gene Name KYAT1 kynurenine aminotransferase 1 [ Homo sapiens (human) ]
Official Symbol KYAT1
Synonyms KYAT1; kynurenine aminotransferase 1; GTK; KAT1; KATI; CCBL1; kynurenine--oxoglutarate transaminase 1; beta-lysase, kidney; cysteine conjugate beta lyase 1; cysteine conjugate-beta lyase, cytoplasmic; cysteine conjugate-beta lyase; cytoplasmic (glutamine transaminase K, kyneurenine aminotransferase); cysteine-S-conjugate beta-lyase; glutamine transaminase K; glutamine--phenylpyruvate transaminase; glutamine-phenylpyruvate aminotransferase; kyneurenine aminotransferase; kynurenine aminotransferase I; kynurenine--oxoglutarate transaminase I; EC 2.6.1.64; EC 2.6.1.7; EC 4.4.1.13
Gene ID 883
mRNA Refseq NM_004059
Protein Refseq NP_004050
MIM 600547
UniProt ID Q16773

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KYAT1 Products

Required fields are marked with *

My Review for All KYAT1 Products

Required fields are marked with *

0
cart-icon