Recombinant Human LAG3, GST-tagged
| Cat.No. : | LAG3-103H |
| Product Overview : | Recombinant Human LAG3(1 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. |
| Molecular Mass : | 65.5 kDa |
| AA Sequence : | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRP ARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASV HWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGL EPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVS QAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE |
| Applications : | ELISA; WB-Re; AP; Array |
| Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LAG3 lymphocyte-activation gene3 [ Homo sapiens ] |
| Official Symbol | LAG3 |
| Synonyms | LAG3; lymphocyte-activationgene 3; CD223; lymphocyte activation gene 3 protein; Protein FDC; FDC;OTTHUMP00000240397; LAG-3 |
| Gene ID | 3902 |
| mRNA Refseq | NM_002286 |
| Protein Refseq | NP_002277 |
| MIM | 153337 |
| UniProt ID | P18627 |
| Chromosome Location | 12p13.32 |
| Function | MHC class II proteinbinding; antigen binding; transmembrane signaling receptor activity |
| ◆ Recombinant Proteins | ||
| LAG3-0353C | Active Recombinant Cynomolgus LAG3 protein, His-tagged | +Inquiry |
| Lag3-39RAF488 | Recombinant Rat Lag3 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| LAG3-467HAF647 | Recombinant Human LAG3 Protein, Met-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| LAG3-783HAF647 | Recombinant Human LAG3 Protein, Fc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| LAG3-3324H | Recombinant Human LAG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
