Recombinant Human LAG3, GST-tagged
Cat.No. : | LAG3-103H |
Product Overview : | Recombinant Human LAG3(1 a.a. - 360 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Lymphocyte-activation protein 3 belongs to Ig superfamily and contains 4 extracellular Ig-like domains. The LAG3 gene contains 8 exons. The sequence data, exon/intron organization, and chromosomal localization all indicate a close relationship of LAG3 to CD4. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAA PGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRP ARRADAGEYRAA VHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASV HWFRNRGQGRVPVRESPHHHLAESF LFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGL EPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTP PGGGPDLLVTGDNGDFTLRLEDVS QAQAGTYTCHIHLQEQQLNATVTLAIITGQPQVGKE |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LAG3 lymphocyte-activation gene3 [ Homo sapiens ] |
Official Symbol | LAG3 |
Synonyms | LAG3; lymphocyte-activationgene 3; CD223; lymphocyte activation gene 3 protein; Protein FDC; FDC;OTTHUMP00000240397; LAG-3 |
Gene ID | 3902 |
mRNA Refseq | NM_002286 |
Protein Refseq | NP_002277 |
MIM | 153337 |
UniProt ID | P18627 |
Chromosome Location | 12p13.32 |
Function | MHC class II proteinbinding; antigen binding; transmembrane signaling receptor activity |
◆ Recombinant Proteins | ||
LAG3-783HF | Recombinant Human LAG3 Protein, Fc-tagged, FITC conjugated | +Inquiry |
LAG3-4400H | Recombinant Human LAG3 Protein (Met1-Leu450), C-His tagged | +Inquiry |
LAG3-3324H | Recombinant Human LAG3 Protein, His (Fc)-Avi-tagged | +Inquiry |
Lag3-1083M | Recombinant Mouse Lag3 protein, His-tagged | +Inquiry |
LAG3-679R | Recombinant Rat LAG3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *