Recombinant Human LAG3 Protein (29-450 aa), His-GST-tagged
| Cat.No. : | LAG3-616H |
| Product Overview : | Recombinant Human LAG3 Protein (29-450 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-GST tag at the N-terminal. Research Area: Immunology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST&His |
| Protein Length : | 29-450 aa |
| Description : | Involved in lymphocyte activation. Binds to HLA class-II antigens. |
| Form : | Tris-based buffer, 50% glycerol |
| Molecular Mass : | 75.6 kDa |
| AA Sequence : | VPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPGAQRSGRAPGALPAGHL |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
| Gene Name | LAG3 lymphocyte-activation gene 3 [ Homo sapiens ] |
| Official Symbol | LAG3 |
| Synonyms | LAG3; CD223; |
| Gene ID | 3902 |
| mRNA Refseq | NM_002286 |
| Protein Refseq | NP_002277 |
| MIM | 153337 |
| UniProt ID | P18627 |
| ◆ Recombinant Proteins | ||
| LAG3-467HAF488 | Recombinant Human LAG3 Protein, Met-tagged, Alexa Fluor 488 conjugated | +Inquiry |
| LAG3-1011C | Recombinant Cynomolgus LAG3 Protein (Met1-Leu450), His-tagged | +Inquiry |
| Lag3-39RAF647 | Recombinant Rat Lag3 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| LAG3-196H | Recombinant Human LAG3 Protein, His\Avi-tagged | +Inquiry |
| Lag3-389M | Active Recombinant Mouse Lag3, Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LAG3-941RCL | Recombinant Rat LAG3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAG3 Products
Required fields are marked with *
My Review for All LAG3 Products
Required fields are marked with *
