Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at IMMUNOLOGY2024™|May 3-7, 2024|Booth #512

Recombinant Human LALBA

Cat.No. : LALBA-27311TH
Product Overview : Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells.
Protein length : 110 amino acids
Molecular Weight : 37.730kDa inclusive of tags
Source : Wheat germ
Tissue specificity : Mammary gland specific. Secreted in milk.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL
Sequence Similarities : Belongs to the glycosyl hydrolase 22 family.
Gene Name : LALBA lactalbumin, alpha- [ Homo sapiens ]
Official Symbol : LALBA
Synonyms : LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7;
Gene ID : 3906
mRNA Refseq : NM_002289
Protein Refseq : NP_002280
MIM : 149750
Uniprot ID : P00709
Chromosome Location : 12q13
Pathway : Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem;
Function : calcium ion binding; lactose synthase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends