Recombinant Human LALBA
Cat.No. : | LALBA-27311TH |
Product Overview : | Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 110 amino acids |
Description : | This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. |
Molecular Weight : | 37.730kDa inclusive of tags |
Tissue specificity : | Mammary gland specific. Secreted in milk. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL |
Sequence Similarities : | Belongs to the glycosyl hydrolase 22 family. |
Gene Name | LALBA lactalbumin, alpha- [ Homo sapiens ] |
Official Symbol | LALBA |
Synonyms | LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; |
Gene ID | 3906 |
mRNA Refseq | NM_002289 |
Protein Refseq | NP_002280 |
MIM | 149750 |
Uniprot ID | P00709 |
Chromosome Location | 12q13 |
Pathway | Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
Function | calcium ion binding; lactose synthase activity; |
◆ Recombinant Proteins | ||
LALBA-705H | Recombinant Human LALBA Protein, Fc-tagged | +Inquiry |
LALBA-4979M | Recombinant Mouse LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
LALBA-4407H | Recombinant Human LALBA Protein (Lys20-Leu142), C-His tagged | +Inquiry |
LALBA-4410H | Recombinant Human LALBA Protein (Lys20-Lys141), N-His tagged | +Inquiry |
Lalba-1288M | Recombinant Mouse Lalba Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
LALBA-8173H | Native Human Lactalbumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
LALBA-4829HCL | Recombinant Human LALBA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LALBA Products
Required fields are marked with *
My Review for All LALBA Products
Required fields are marked with *
0
Inquiry Basket