Recombinant Human LALBA
| Cat.No. : | LALBA-27311TH |
| Product Overview : | Recombinant fragment of Human alpha Lactalbumin with a N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | Non |
| Protein Length : | 110 amino acids |
| Description : | This gene encodes alpha-lactalbumin, a principal protein of milk. Alpha-lactalbumin forms the regulatory subunit of the lactose synthase (LS) heterodimer and beta 1,4-galactosyltransferase (beta4Gal-T1) forms the catalytic component. Together, these proteins enable LS to produce lactose by transfering galactose moieties to glucose. As a monomer, alpha-lactalbumin strongly binds calcium and zinc ions and may possess bactericidal or antitumor activity. A folding variant of alpha-lactalbumin, called HAMLET, likely induces apoptosis in tumor and immature cells. |
| Molecular Weight : | 37.730kDa inclusive of tags |
| Tissue specificity : | Mammary gland specific. Secreted in milk. |
| Form : | Liquid |
| Purity : | Proprietary Purification |
| Storage buffer : | pH: 8.00Constituents:0.79% Tris HCl, 0.3% Glutathione |
| Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | DIDGYGGIALPELICTMFHTSGYDTQAIVENNESTEYGLF QISNKLWCKSSQVPQSRNICDISCDKFLDDDITDDIMCAK KILDIKGIDYWLAHKALCTEKLEQWLCEKL |
| Sequence Similarities : | Belongs to the glycosyl hydrolase 22 family. |
| Gene Name | LALBA lactalbumin, alpha- [ Homo sapiens ] |
| Official Symbol | LALBA |
| Synonyms | LALBA; lactalbumin, alpha-; alpha-lactalbumin; LYZL7; |
| Gene ID | 3906 |
| mRNA Refseq | NM_002289 |
| Protein Refseq | NP_002280 |
| MIM | 149750 |
| Uniprot ID | P00709 |
| Chromosome Location | 12q13 |
| Pathway | Galactose metabolism, organism-specific biosystem; Galactose metabolism, conserved biosystem; Metabolic pathways, organism-specific biosystem; |
| Function | calcium ion binding; lactose synthase activity; |
| ◆ Recombinant Proteins | ||
| LALBA-5738H | Recombinant Human LALBA protein, His & T7-tagged | +Inquiry |
| LALBA-4410H | Recombinant Human LALBA Protein (Lys20-Lys141), N-His tagged | +Inquiry |
| LALBA-3327H | Recombinant Human LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
| LALBA-255H | Recombinant Human LALBA | +Inquiry |
| LALBA-306H | Recombinant Human LALBA Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LALBA-8173H | Native Human Lactalbumin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LALBA-4829HCL | Recombinant Human LALBA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LALBA Products
Required fields are marked with *
My Review for All LALBA Products
Required fields are marked with *
