Recombinant Human LAMB1, His-tagged
| Cat.No. : | LAMB1-29912TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1388-1786 of Human Laminin beta 1 with an N-terminal His tag; MWt 52kDa. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1388-1786 a.a. |
| Description : | Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins are composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively) and they form a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the beta chain isoform laminin, beta 1. The beta 1 chain has 7 structurally distinct domains which it shares with other beta chain isomers. The C-terminal helical region containing domains I and II are separated by domain alpha, domains III and V contain several EGF-like repeats, and domains IV and VI have a globular conformation. Laminin, beta 1 is expressed in most tissues that produce basement membranes, and is one of the 3 chains constituting laminin 1, the first laminin isolated from Engelbreth-Holm-Swarm (EHS) tumor. A sequence in the beta 1 chain that is involved in cell attachment, chemotaxis, and binding to the laminin receptor was identified and shown to have the capacity to inhibit metastasis. |
| Conjugation : | HIS |
| Form : | Lyophilised:Reconstitute with 108 μl aqua dest |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | (Amino acid sequence (Sequence determined by 5 Sequencing))LDLSAAAEMTCGTPPGASCSETECGG PNCRTDEGERKCGGPGCGGLVTVAHNAWQKAMDLDQDV LSALAEVEQLSKMVSEAKLRADEAKQSAEDILLKTNAT KEKMDKSNEELRNLIKQIRNFLTQDSADLDSIEAVANEVL KMEMPSTPQQLQNLTEDIRERVESLSQVEVILQHSAAD IARAEMLLEEAKRASKSATDVKVTADMVKEALEEAEKA QVAAEKAIKQADEDIQGTQNLLTSIESETAASEETLFN ASQRISELERNVEELKRKAAQNSGEAEYIEKVVYTVKQSAEDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEM LQNEAKTLLAQANSKLQLLKDLERKYEDNQRYLEDKAQ ELARLEGEVRSLLKDISQKVAVYSTCL |
| Sequence Similarities : | Contains 13 laminin EGF-like domains.Contains 1 laminin IV type B domain.Contains 1 laminin N-terminal domain. |
| Gene Name | LAMB1 laminin, beta 1 [ Homo sapiens ] |
| Official Symbol | LAMB1 |
| Synonyms | LAMB1; laminin, beta 1; CLM, cutis laxa with marfanoid phenotype; laminin subunit beta-1; |
| Gene ID | 3912 |
| mRNA Refseq | NM_002291 |
| Protein Refseq | NP_002282 |
| MIM | 150240 |
| Uniprot ID | P07942 |
| Chromosome Location | 7q22 |
| Pathway | Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem; |
| Function | enzyme binding; extracellular matrix structural constituent; glycosphingolipid binding; integrin binding; structural molecule activity; |
| ◆ Recombinant Proteins | ||
| Lamb1-1729R | Recombinant Rat Lamb1 Protein, His-tagged | +Inquiry |
| LAMB1-2565H | Recombinant Human SLAMB1 protein, His-tagged | +Inquiry |
| LAMB1-29912TH | Recombinant Human LAMB1, His-tagged | +Inquiry |
| Lamb1-177H | Recombinant Mouse Lamb1 Protein, His/GST-tagged | +Inquiry |
| LAMB1-2564H | Recombinant Human LAMB1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMB1 Products
Required fields are marked with *
My Review for All LAMB1 Products
Required fields are marked with *




