Recombinant Human Laminin α4, GST-tagged
Cat.No. : | LAMA4-6953H |
Product Overview : | Human LAMA4full-length ORF ( AAH04241.1, 1 a.a. - 120 a.a.) recombinant protein withGST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Laminin subunitalpha-4 is a protein that in humans is encoded by the LAMA4 gene. Laminins, afamily of extracellular matrix glycoproteins, are the major noncollagenousconstituent of basement membranes. They have been implicated in a widevariety of biological processes including cell adhesion, differentiation,migration, signaling, neurite outgrowth and metastasis. Laminins are composedof 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, andB2, respectively) and they form a cruciform structure consisting of 3 shortarms, each formed by a different chain, and a long arm composed of all 3chains. Each laminin chain is a multidomain protein encoded by a distinctgene. Several isoforms of each chain have been described. |
MolecularMass : | 38.94 kDa |
Sequence : | MALSSAWRSVLPLWLLWSAACSRAASGDDNAFPFDIEGSSAVGRQDPPETSEPRVALGRLPPAAEVQCPCHCHPAGAPAPPRAVPHSSFSLSPPLSSPQCLESFTWARSVRKLEIKSFPL |
Purity : | GlutathioneSepharose 4 Fast Flow |
Buffer : | 50 mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer. |
Format : | supplied in 50 mMTris-HCl, 10 mM reduced Glutathione, pH 8.0, and do not contain any known hazardingredient |
Quality ControlTesting : | 12.5% SDS-PAGEStained with Coomassie Blue. |
Applications : | Enzyme-linkedImmunoabsorbent Assay; Western Blot (Recombinant protein) |
Storage : | Store at -80°C.Aliquot to avoid repeated freezing and thawing. |
Gene Name | LAMA4 laminin, alpha 4 [ Homosapiens ] |
Official Symbol | LAMA4 |
Synonyms | LAMA4;laminin, alpha 4; LAMA3; LAMA4*-1; DKFZp686D23145; Laminin-14 subunit alpha;Laminin-8 subunit alpha; Laminin-9 subunit alpha |
Gene ID | 3910 |
mRNA Refseq | NM_001105206 |
Protein Refseq | NP_001098676 |
MIM | 600133 |
UniProt ID | Q16363 |
Chromosome Location | 6q21 |
Pathway | extracellularmatrix structural constituent; receptor binding |
Function | Africantrypanosomiasis; Amoebiasis; ECM-receptor interaction; FOXM1 transcriptionfactor networ; Focal adhesion; Pathways in cancer; Small cell lung cancer;Toxoplasmosis |
◆ Recombinant Proteins | ||
LAMA4-3605Z | Recombinant Zebrafish LAMA4 | +Inquiry |
LAMA4-276HF | Recombinant Full Length Human Lamininα4 Protein, GST-tagged | +Inquiry |
LAMA4-213H | Recombinant Human LAMA4 Protein, His-tagged | +Inquiry |
LAMA4-6956H | Recombinant Human Laminin α4, GST-Tagged | +Inquiry |
LAMA4-6954M | Active Recombinant Mouse Laminin α4, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMA4-967HCL | Recombinant Human LAMA4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMA4 Products
Required fields are marked with *
My Review for All LAMA4 Products
Required fields are marked with *
0
Inquiry Basket