Recombinant Human LAMP3 Protein, His-tagged

• Cat.No.: LAMP3-049H
• Product Overview: Recombinant Human LAMP3 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction. Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process. Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway. May also play a role in dendritic cell function and in adaptive immunity.
• Molecular Mass: ~47 kDa
• AA Sequence: KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT
• Purity: Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE).
• Notes: For research use only, not for use in diagnostic procedure.
• Storage: Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles.
• Storage Buffer: PBS, 4M Urea, pH7.4

Gene Information

• Gene Name: LAMP3 lysosomal-associated membrane protein 3 [ Homo sapiens (human) ]
• Official Symbol: LAMP3
• Synonyms: LAMP3; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; CD208; DC LAMP; DCLAMP; LAMP; TSC403; DC-lysosome-associated membrane glycoprotein; LAMP-3; DC-LAMP
• Gene ID: 27074
• mRNA Refseq: NM_014398
• Protein Refseq: NP_055213
• MIM: 605883
• UniProt ID: Q9UQV4