Recombinant Human LAMP3 Protein, His-tagged
Cat.No. : | LAMP3-049H |
Product Overview : | Recombinant Human LAMP3 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | Lysosomal membrane glycoprotein which plays a role in the unfolded protein response (UPR) that contributes to protein degradation and cell survival during proteasomal dysfunction. Plays a role in the process of fusion of the lysosome with the autophagosome, thereby modulating the autophagic process. Promotes hepatocellular lipogenesis through activation of the PI3K/Akt pathway. May also play a role in dendritic cell function and in adaptive immunity. |
Molecular Mass : | ~47 kDa |
AA Sequence : | KAFPETRDYSQPTAAATVQDIKKPVQQPAKQAPHQTLAARFMDGHITFQTAATVKIPTTTPATTKNTATTSPITYTLVTTQATPNNSHTAPPVTEVTVGPSLAPYSLPPTITPPAHTTGTSSSTVSHTTGNTTQPSNQTTLPATLSIALHKSTTGQKPVQPTHAPGTTAAAHNTTRTAAPASTVPGPTLAPQPSSVKTGIYQVLNGSRLCIKAEMGIQLIVQDKESVFSPRRYFNIDPNATQASGNCGTRKSNLLLNFQGGFVNLTFTKDEESYYISEVGAYLTVSDPETIYQGIKHAVVMFQTAVGHSFKCVSEQSLQLSAHLQVKTTDVQLQAFDFEDDHFGNVDECSSDYT |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | LAMP3 lysosomal-associated membrane protein 3 [ Homo sapiens (human) ] |
Official Symbol | LAMP3 |
Synonyms | LAMP3; lysosomal-associated membrane protein 3; lysosome-associated membrane glycoprotein 3; CD208; DC LAMP; DCLAMP; LAMP; TSC403; DC-lysosome-associated membrane glycoprotein; LAMP-3; DC-LAMP; |
Gene ID | 27074 |
mRNA Refseq | NM_014398 |
Protein Refseq | NP_055213 |
MIM | 605883 |
UniProt ID | Q9UQV4 |
◆ Recombinant Proteins | ||
LAMP3-3005R | Recombinant Rat LAMP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAMP3-2458R | Recombinant Rhesus monkey LAMP3 Protein, His-tagged | +Inquiry |
LAMP3-1603R | Recombinant Rhesus Monkey LAMP3 Protein, hIgG4-tagged | +Inquiry |
LAMP3-258R | Recombinant Rhesus LAMP3 Protein, His-tagged | +Inquiry |
LAMP3-127C | Recombinant Cynomolgus LAMP3, His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAMP3-2763HCL | Recombinant Human LAMP3 cell lysate | +Inquiry |
LAMP3-1016CCL | Recombinant Cynomolgus LAMP3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAMP3 Products
Required fields are marked with *
My Review for All LAMP3 Products
Required fields are marked with *
0
Inquiry Basket