Recombinant Human LAP3 protein, His-tagged
Cat.No. : | LAP3-3829H |
Product Overview : | Recombinant Human LAP3 protein(271-519 aa), fused to His tag, was expressed in E. coli. |
Availability | May 21, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 271-519 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | NANEPPLVFVGKGITFDSGGISIKASANMDLMRADMGGAATICSAIVSAAKLNLPINIIGLAPLCENMPSGKANKPGDVVRAKNGKTIQVDNTDAEGRLILADALCYAHTFNPKVILNAATLTGAMDVALGSGATGVFTNSSWLWNKLFEASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LAP3 leucine aminopeptidase 3 [ Homo sapiens ] |
Official Symbol | LAP3 |
Synonyms | LAP3; leucine aminopeptidase 3; PEPS, peptidase S; cytosol aminopeptidase; LAP; LAPEP; LAP-3; peptidase S; leucyl aminopeptidase; prolyl aminopeptidase; proline aminopeptidase; PEPS; |
Gene ID | 51056 |
mRNA Refseq | NM_015907 |
Protein Refseq | NP_056991 |
MIM | 170250 |
UniProt ID | P28838 |
◆ Recombinant Proteins | ||
LAP3-2283R | Recombinant Rhesus Macaque LAP3 Protein, His (Fc)-Avi-tagged | +Inquiry |
LAP3-3354R | Recombinant Rat LAP3 Protein | +Inquiry |
LAP3-6057H | Recombinant Human LAP3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lap3-2760R | Recombinant Rat Lap3 protein, His-tagged | +Inquiry |
LAP3-689H | Recombinant Human LAP3 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAP3-4824HCL | Recombinant Human LAP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LAP3 Products
Required fields are marked with *
My Review for All LAP3 Products
Required fields are marked with *
0
Inquiry Basket