Recombinant Human LAPTM4A protein, GST-tagged
Cat.No. : | LAPTM4A-301425H |
Product Overview : | Recombinant Human LAPTM4A (103-187 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Ser103-Tyr187 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | SYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCY |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | LAPTM4A lysosomal protein transmembrane 4 alpha [ Homo sapiens ] |
Official Symbol | LAPTM4A |
Synonyms | LAPTM4A; lysosomal protein transmembrane 4 alpha; lysosomal associated protein transmembrane 4 alpha , MBNT; lysosomal-associated transmembrane protein 4A; HUMORF13; KIAA0108; LAPTM4; Mtrp; membrane nucleoside transporter; golgi 4-transmembrane-spanning transporter MTP; lysosomal-associated protein transmembrane 4 alpha; MBNT; |
Gene ID | 9741 |
mRNA Refseq | NM_014713 |
Protein Refseq | NP_055528 |
UniProt ID | Q15012 |
◆ Recombinant Proteins | ||
LAPTM4A-394C | Recombinant Cynomolgus Monkey LAPTM4A Protein, His (Fc)-Avi-tagged | +Inquiry |
LAPTM4A-3355R | Recombinant Rat LAPTM4A Protein | +Inquiry |
LAPTM4A-648C | Recombinant Cynomolgus LAPTM4A Protein, His-tagged | +Inquiry |
LAPTM4A-12716Z | Recombinant Zebrafish LAPTM4A | +Inquiry |
RFL20064HF | Recombinant Full Length Human Lysosomal-Associated Transmembrane Protein 4A(Laptm4A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LAPTM4A-4823HCL | Recombinant Human LAPTM4A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAPTM4A Products
Required fields are marked with *
My Review for All LAPTM4A Products
Required fields are marked with *