Recombinant Human LAPTM4A protein, GST-tagged

• Cat.No.: LAPTM4A-301425H
• Product Overview: Recombinant Human LAPTM4A protein(103-187 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 103-187 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH).
• AASequence: SYQVGWLIPFFCYRLFDFVLSCLVAISSLTYLPRIKEYLDQLPDFPYKDDLLALDSSCLLFIVLVFFALFIIFKAYLINCVWNCY
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: LAPTM4A lysosomal protein transmembrane 4 alpha [ Homo sapiens ]
• Official Symbol: LAPTM4A
• Synonyms: LAPTM4A; lysosomal protein transmembrane 4 alpha; lysosomal associated protein transmembrane 4 alpha , MBNT; lysosomal-associated transmembrane protein 4A; HUMORF13; KIAA0108; LAPTM4; Mtrp; membrane nucleoside transporter; golgi 4-transmembrane-spanning transporter MTP; lysosomal-associated protein transmembrane 4 alpha; MBNT
• Gene ID: 9741
• mRNA Refseq: NM_014713
• Protein Refseq: NP_055528
• UniProt ID: Q15012