Recombinant Human LAPTM5 protein, GST-tagged
Cat.No. : | LAPTM5-7344H |
Product Overview : | Recombinant Human LAPTM5 protein(213-262 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 213-262 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | YRLIKCMNSVEEKKNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | LAPTM5 lysosomal protein transmembrane 5 [ Homo sapiens ] |
Official Symbol | LAPTM5 |
Synonyms | LAPTM5; lysosomal protein transmembrane 5; lysosomal multispanning membrane protein 5; lysosomal-associated transmembrane protein 5; retinoic acid-inducible E3 protein; human retinoic acid-inducible E3 protein; CD40-ligand-activated specific transcripts; lysosomal-associated multitransmembrane protein 5; lysosomal associated multispanning membrane protein 5; CLAST6; FLJ61683; FLJ97251; MGC125860; MGC125861; |
Gene ID | 7805 |
mRNA Refseq | NM_006762 |
Protein Refseq | NP_006753 |
MIM | 601476 |
UniProt ID | Q13571 |
◆ Cell & Tissue Lysates | ||
LAPTM5-375HCL | Recombinant Human LAPTM5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LAPTM5 Products
Required fields are marked with *
My Review for All LAPTM5 Products
Required fields are marked with *