Recombinant Human LAPTM5 protein, GST-tagged

• Cat.No.: LAPTM5-7344H
• Product Overview: Recombinant Human LAPTM5 protein(213-262 aa), fused with N-terminal GST tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 213-262 aa
• Form: The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients.
• AASequence: YRLIKCMNSVEEKKNSKMLQKVVLPSYEEALSLPSKTPEGGPAPPPYSEV
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.

Gene Information

• Gene Name: LAPTM5 lysosomal protein transmembrane 5 [ Homo sapiens ]
• Official Symbol: LAPTM5
• Synonyms: LAPTM5; lysosomal protein transmembrane 5; lysosomal multispanning membrane protein 5; lysosomal-associated transmembrane protein 5; retinoic acid-inducible E3 protein; human retinoic acid-inducible E3 protein; CD40-ligand-activated specific transcripts; lysosomal-associated multitransmembrane protein 5; lysosomal associated multispanning membrane protein 5; CLAST6; FLJ61683; FLJ97251; MGC125860; MGC125861
• Gene ID: 7805
• mRNA Refseq: NM_006762
• Protein Refseq: NP_006753
• MIM: 601476
• UniProt ID: Q13571