Recombinant Human LARP1B Protein (1-201 aa), His-SUMO-tagged

Cat.No. : LARP1B-1038H
Product Overview : Recombinant Human LARP1B Protein (1-201 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 7.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-201 aa
Form : Tris-based buffer, 50% glycerol
Molecular Mass : 40.1 kDa
AA Sequence : MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with concentration instruction is sent along with the products.
Gene Name LARP1B La ribonucleoprotein domain family, member 1B [ Homo sapiens ]
Official Symbol LARP1B
Synonyms LARP1B; DKFZp434K245; DKFZp686E0316; FLJ10378; LARP2; MGC75174; MGC117277; DKFZp686L13217;
Gene ID 55132
mRNA Refseq NM_018078
Protein Refseq NP_060548
UniProt ID Q659C4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LARP1B Products

Required fields are marked with *

My Review for All LARP1B Products

Required fields are marked with *

0
cart-icon
0
compare icon