Recombinant Human LARP1B Protein (1-201 aa), His-SUMO-tagged
Cat.No. : | LARP1B-1038H |
Product Overview : | Recombinant Human LARP1B Protein (1-201 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-SUMO tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length of Isoform 7. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&SUMO |
Protein Length : | 1-201 aa |
Form : | Tris-based buffer, 50% glycerol |
Molecular Mass : | 40.1 kDa |
AA Sequence : | MDSRDRGPGTSSVSTSNASPSEGAPLAGSYGCTPHSFPKFQHPSHELLKENGFTQQVYHKYRRRCLSERKRLGIGQSQEMNTLFRFWSFFLRDHFNKKMYEEFRQLAWEDAKENYRYGLECLFRFYSYGLEKKFRREIFQDFQEETKKDYESGQLYGLEKFWAYLKYSQSKTQSIDPKLQEYLCSFKRLEDFRVDEADPIE |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with concentration instruction is sent along with the products. |
Gene Name | LARP1B La ribonucleoprotein domain family, member 1B [ Homo sapiens ] |
Official Symbol | LARP1B |
Synonyms | LARP1B; DKFZp434K245; DKFZp686E0316; FLJ10378; LARP2; MGC75174; MGC117277; DKFZp686L13217; |
Gene ID | 55132 |
mRNA Refseq | NM_018078 |
Protein Refseq | NP_060548 |
UniProt ID | Q659C4 |
◆ Recombinant Proteins | ||
LARP1B-1038H | Recombinant Human LARP1B Protein (1-201 aa), His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LARP1B Products
Required fields are marked with *
My Review for All LARP1B Products
Required fields are marked with *