Recombinant Human LATS1 protein, His&Myc-tagged
Cat.No. : | LATS1-5356H |
Product Overview : | Recombinant Human LATS1 protein(O95835)(705-1090aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 705-1090aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 49.4 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | FVKIKTLGIGAFGEVCLARKVDTKALYATKTLRKKDVLLRNQVAHVKAERDILAEADNEWVVRLYYSFQDKDNLYFVMDYIPGGDMMSLLIRMGIFPESLARFYIAELTCAVESVHKMGFIHRDIKPDNILIDRDGHIKLTDFGLCTGFRWTHDSKYYQSGDHPRQDSMDFSNEWGDPSSCRCGDRLKPLERRAARQHQRCLAHSLVGTPNYIAPEVLLRTGYTQLCDWWSVGVILFEMLVGQPPFLAQTPLETQMKVINWQTSLHIPPQAKLSPEASDLIIKLCRGPEDRLGKNGADEIKAHPFFKTIDFSSDLRQQSASYIPKITHPTDTSNFDPVDPDKLWSDDNEEENVNDTLNGWYKNGKHPEHAFYEFTFRRFFDDNGYP |
Gene Name | LATS1 LATS, large tumor suppressor, homolog 1 (Drosophila) [ Homo sapiens ] |
Official Symbol | LATS1 |
Synonyms | LATS1; LATS, large tumor suppressor, homolog 1 (Drosophila); LATS (large tumor suppressor, Drosophila) homolog 1; serine/threonine-protein kinase LATS1; WARTS; h-warts; WARTS protein kinase; large tumor suppressor homolog 1; wts; |
Gene ID | 9113 |
mRNA Refseq | NM_004690 |
Protein Refseq | NP_004681 |
MIM | 603473 |
UniProt ID | O95835 |
◆ Recombinant Proteins | ||
LATS1-1423H | Active Recombinant Human LATS1, GST-tagged | +Inquiry |
LATS1-8971M | Recombinant Mouse LATS1 Protein | +Inquiry |
LATS1-5003M | Recombinant Mouse LATS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LATS1-5356H | Recombinant Human LATS1 protein, His&Myc-tagged | +Inquiry |
LATS1-2707Z | Recombinant Zebrafish LATS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LATS1-974HCL | Recombinant Human LATS1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LATS1 Products
Required fields are marked with *
My Review for All LATS1 Products
Required fields are marked with *