Recombinant Human LBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LBX1-3351H |
Product Overview : | LBX1 MS Standard C13 and N15-labeled recombinant protein (NP_006553) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene and the orthologous mouse gene were found by their homology to the Drosophila lady bird early and late homeobox genes. In the mouse, this gene is a key regulator of muscle precursor cell migration and is required for the acquisition of dorsal identities of forelimb muscles. |
Molecular Mass : | 30 kDa |
AA Sequence : | MTSKEDGKAAPGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLAAADKHAQGGLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVDDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LBX1 ladybird homeobox 1 [ Homo sapiens (human) ] |
Official Symbol | LBX1 |
Synonyms | LBX1; ladybird homeobox 1; ladybird homeobox homolog 1 (Drosophila); transcription factor LBX1; HPX6; LBX1H; lady bird-like homeobox; ladybird homeobox homolog 1; ladybird homeobox protein homolog 1; transcription factor similar to D. melanogaster homeodomain protein lady bird late; HPX-6; homeobox; |
Gene ID | 10660 |
mRNA Refseq | NM_006562 |
Protein Refseq | NP_006553 |
MIM | 604255 |
UniProt ID | P52954 |
◆ Recombinant Proteins | ||
LBX1-8976M | Recombinant Mouse LBX1 Protein | +Inquiry |
LBX1-4094C | Recombinant Chicken LBX1 | +Inquiry |
LBX1-348H | Recombinant Human LBX1 Protein, MYC/DDK-tagged | +Inquiry |
LBX1-3351H | Recombinant Human LBX1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LBX1-2293R | Recombinant Rhesus Macaque LBX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LBX1 Products
Required fields are marked with *
My Review for All LBX1 Products
Required fields are marked with *