Recombinant Human LCE3B Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LCE3B-2924H |
Product Overview : | LCE3B MS Standard C13 and N15-labeled recombinant protein (NP_848520) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Precursors of the cornified envelope of the stratum corneum. |
Molecular Mass : | 9.6 kDa |
AA Sequence : | MSCQQNQQQCQPLPKCPSPKCPPKSSAQCLPPASSCCAPRPGCCGGPSSEGGCCLSHHRCCRSHRCRRQSSNSCDRGSGQQDGASDCGYGSGGCCTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LCE3B late cornified envelope 3B [ Homo sapiens (human) ] |
Official Symbol | LCE3B |
Synonyms | LCE3B; late cornified envelope 3B; LEP14; late cornified envelope protein 3B; late envelope protein 14 |
Gene ID | 353143 |
mRNA Refseq | NM_178433 |
Protein Refseq | NP_848520 |
MIM | 612614 |
UniProt ID | Q5TA77 |
◆ Recombinant Proteins | ||
LCE3B-339H | Recombinant Human LCE3B Protein, MYC/DDK-tagged | +Inquiry |
LCE3B-2924H | Recombinant Human LCE3B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LCE3B Products
Required fields are marked with *
My Review for All LCE3B Products
Required fields are marked with *