Recombinant Human LDHA, GST-tagged
| Cat.No. : | LDHA-261H |
| Product Overview : | Recombinant Human LDHA(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. The protein is found predominantly in muscle tissue and belongs to the lactate dehydrogenase family. Mutations in this gene have been linked to exertional myoglobinuria. Multiple transcript variants encoding different isoforms have been found for this gene. The human genome contains several non-transcribed pseudogenes of this gene. |
| Molecular Mass : | 63.1 kDa |
| AA Sequence : | MATLKDQLIYNLLKEEQTPQNKITVVGVGAVGMACAISILMKDLADELALVDVIEDKLKGEMMDLQHGSLFLRTP KIVSGKDYNVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNVVKYSPNCKLLIVSNPVDILTYVAWKI SGFPKNRVIGSGCNLDSARFRYLMGERLGVHPLSCHGWVLGEHGDSSVPVWSGMNVAGVSLKTLHPDLGTDKDKE QWKEVHKQVVESAYEVIKLKGYTSWAIGLSVADLAESIMKNLRRVHPVSTMIKGLYGIKDDVFLSVPCILGQNGI SDLVKVTLTSEEEARLKKSADTLWGIQKELQF |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LDHA lactate dehydrogenase A [ Homo sapiens (human) ] |
| Official Symbol | LDHA |
| Synonyms | LDHA; lactate dehydrogenase A; LDH1; LDHM; GSD11; PIG19; L-lactate dehydrogenase A chain; LDH-A; LDH-M; LDH muscle subunit; lactate dehydrogenase M; proliferation-inducing gene 19; renal carcinoma antigen NY-REN-59; cell proliferation-inducing gene 19 protein; EC 1.1.1.27 |
| Gene ID | 3939 |
| mRNA Refseq | NM_005566 |
| Protein Refseq | NP_005557 |
| MIM | 150000 |
| UniProt ID | P00338 |
| Chromosome Location | 11p15.4 |
| Pathway | Central carbon metabolism in cancer; Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis |
| Function | L-lactate dehydrogenase activity; protein binding |
| ◆ Recombinant Proteins | ||
| LDHA-1914S | Recombinant Staphylococcus Aureus LDHA Protein (1-317 aa), His-SUMO-tagged | +Inquiry |
| LDHA-3157H | Recombinant Human LDHA protein, His-tagged | +Inquiry |
| LDHA-8843Z | Recombinant Zebrafish LDHA | +Inquiry |
| LDHA-6836C | Recombinant Chicken LDHA | +Inquiry |
| LDHA-1284H | Recombinant Human LDHA Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LDHA-26867TH | Native Human LDHA | +Inquiry |
| LDHA-8315C | Native Chicken LDHA | +Inquiry |
| LDH1-18H | Native Human Lactate Dehydrogenase 1 | +Inquiry |
| LDH1-219H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
| LDH1-16H | Active Native Human Lactate Dehydrogenase 1 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDHA-4790HCL | Recombinant Human LDHA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHA Products
Required fields are marked with *
My Review for All LDHA Products
Required fields are marked with *



