Recombinant Human LDHC, GST-tagged
| Cat.No. : | LDHC-258H |
| Product Overview : | Recombinant Human LDHC(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region. |
| Molecular Mass : | 62.7 kDa |
| AA Sequence : | MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTS KITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKI SGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKE HWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV SDVVKINLNSEEEALFKKSAETLWNIQKDLIF |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80ºC. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | LDHC lactate dehydrogenase C [ Homo sapiens (human) ] |
| Official Symbol | LDHC |
| Synonyms | LDHC; lactate dehydrogenase C; CT32; LDH3; LDHX; L-lactate dehydrogenase C chain; LDH testis subunit; LDH-C; LDH-X; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; NP_002292.1; EC 1.1.1.27; NP_059144.1 |
| Gene ID | 3948 |
| mRNA Refseq | NM_002301 |
| Protein Refseq | NP_002292 |
| MIM | 150150 |
| UniProt ID | P07864 |
| Chromosome Location | 11p15.1 |
| Pathway | Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism |
| Function | L-lactate dehydrogenase activity |
| ◆ Recombinant Proteins | ||
| LDHC-259H | Recombinant Human LDHC, GST-tagged | +Inquiry |
| Ldhc-1307M | Recombinant Mouse Ldhc Protein, MYC/DDK-tagged | +Inquiry |
| LDHC-295H | Recombinant Human LDHC Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| LDHC-002H | Recombinant Human LDHC Protein, Myc/DDK-tagged | +Inquiry |
| Ldhc-003H | Recombinant Mouse Ldhc Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Native Proteins | ||
| LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDH3-223H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDHC-28045TH | Native Human LDHC | +Inquiry |
| LDH3-21H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| LDH3-124H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LDHC-4787HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
| LDHC-4786HCL | Recombinant Human LDHC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LDHC Products
Required fields are marked with *
My Review for All LDHC Products
Required fields are marked with *



