Recombinant Human LDHC, GST-tagged

Cat.No. : LDHC-258H
Product Overview : Recombinant Human LDHC(1 a.a. - 332 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Lactate dehydrogenase C catalyzes the conversion of L-lactate and NAD to pyruvate and NADH in the final step of anaerobic glycolysis. LDHC is testis-specific and belongs to the lactate dehydrogenase family. Two transcript variants have been detected which differ in the 5' untranslated region.
Molecular Mass : 62.7 kDa
AA Sequence : MSTVKEQLIEKLIEDDENSQCKITIVGTGAVGMACAISILLKDLADELALVDVALDKLKGEMMDLQHGSLFFSTS KITSGKDYSVSANSRIVIVTAGARQQEGETRLALVQRNVAIMKSIIPAIVHYSPDCKILVVSNPVDILTYIVWKI SGLPVTRVIGSGCNLDSARFRYLIGEKLGVHPTSCHGWIIGEHGDSSVPLWSGVNVAGVALKTLDPKLGTDSDKE HWKNIHKQVIQSAYEIIKLKGYTSWAIGLSVMDLVGSILKNLRRVHPVSTMVKGLYGIKEELFLSIPCVLGRNGV SDVVKINLNSEEEALFKKSAETLWNIQKDLIF
Applications : ELISA; WB-Re; AP; Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LDHC lactate dehydrogenase C [ Homo sapiens (human) ]
Official Symbol LDHC
Synonyms LDHC; lactate dehydrogenase C; CT32; LDH3; LDHX; L-lactate dehydrogenase C chain; LDH testis subunit; LDH-C; LDH-X; cancer/testis antigen 32; lactate dehydrogenase C4; lactate dehydrogenase c variant 1; lactate dehydrogenase c variant 3; lactate dehydrogenase c variant 4; NP_002292.1; EC 1.1.1.27; NP_059144.1
Gene ID 3948
mRNA Refseq NM_002301
Protein Refseq NP_002292
MIM 150150
UniProt ID P07864
Chromosome Location 11p15.1
Pathway Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism
Function L-lactate dehydrogenase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LDHC Products

Required fields are marked with *

My Review for All LDHC Products

Required fields are marked with *

0
cart-icon