Recombinant Human LECT2 protein, GST-tagged
| Cat.No. : | LECT2-9032H |
| Product Overview : | Recombinant Human LECT2(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 151 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| AA Sequence : | MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPFTGMIV GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | LECT2 leukocyte cell-derived chemotaxin 2 [ Homo sapiens ] |
| Official Symbol | LECT2 |
| Synonyms | LECT2; leukocyte cell-derived chemotaxin 2; leukocyte cell-derived chemotaxin-2; chm II; chm2; chondromodulin-II; chm-II; MGC126628; |
| Gene ID | 3950 |
| mRNA Refseq | NM_002302 |
| Protein Refseq | NP_002293 |
| MIM | 602882 |
| UniProt ID | O14960 |
| Chromosome Location | 5q31.1 |
| Pathway | C-MYB transcription factor network, organism-specific biosystem; |
| ◆ Recombinant Proteins | ||
| LECT2-601HF | Recombinant Full Length Human LECT2 Protein, GST-tagged | +Inquiry |
| LECT2-9035M | Recombinant Mouse Lect2 protein, His/T7-tagged | +Inquiry |
| LECT2-7594HFL | Recombinant Full Length Human LECT2 protein, Flag-tagged | +Inquiry |
| Lect2-265R | Recombinant Rat Lect2 Protein, His-tagged | +Inquiry |
| LECT2-5031M | Recombinant Mouse LECT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LECT2-4779HCL | Recombinant Human LECT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LECT2 Products
Required fields are marked with *
My Review for All LECT2 Products
Required fields are marked with *



