"LECT2" Related Products

Expand
Expand
Expand

Recombinant Human LECT2 protein, GST-tagged

Cat.No.: LECT2-9032H
Product Overview: Recombinant Human LECT2(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in wheat germ.
Source: Wheat germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Protein length: 1 a.a. - 151 a.a.
AA Sequence: MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPFTGMIV GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: LECT2 leukocyte cell-derived chemotaxin 2 [ Homo sapiens ]
Official Symbol: LECT2
Synonyms: LECT2; leukocyte cell-derived chemotaxin 2; leukocyte cell-derived chemotaxin-2; chm II; chm2; chondromodulin-II; chm-II; MGC126628;
Gene ID: 3950
mRNA Refseq: NM_002302
Protein Refseq: NP_002293
MIM: 602882
UniProt ID: O14960
Chromosome Location: 5q31.1
Pathway: C-MYB transcription factor network, organism-specific biosystem;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.