Recombinant Human LECT2 protein, GST-tagged

• Cat.No.: LECT2-9032H
• Product Overview: Recombinant Human LECT2(1 a.a. - 151 a.a.) fused with GST tag at N-terminal was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Protein Length: 1 a.a. - 151 a.a.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• AA Sequence: MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQGVDVLCSAGSTVYAPFTGMIV GQEKPYQNKNAINNGVRISGRGFCVKMFYIKPIKYKGPIKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAY L
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: LECT2 leukocyte cell-derived chemotaxin 2 [ Homo sapiens ]
• Official Symbol: LECT2
• Synonyms: LECT2; leukocyte cell-derived chemotaxin 2; leukocyte cell-derived chemotaxin-2; chm II; chm2; chondromodulin-II; chm-II; MGC126628
• Gene ID: 3950
• mRNA Refseq: NM_002302
• Protein Refseq: NP_002293
• MIM: 602882
• UniProt ID: O14960
• Chromosome Location: 5q31.1
• Pathway: C-MYB transcription factor network, organism-specific biosystem