Recombinant Human LEF1 protein, GST-tagged

• Cat.No.: LEF1-301549H
• Product Overview: Recombinant Human LEF1 (1-98 aa) protein, fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: Met1-Asp98
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AA Sequence: MPQLSGGGGGGGGDPELCATDEMIPFKDEGDPQKEKIFAEISHPEEEGDLADIKSSLVNESEIIPASNGHEVARQAQTSQEPYHDKAREHPDDGKHPD
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Stability: Store for up to 12 months at -20°C to -80°C as lyophilized powder.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.

Gene Information

• Gene Name: LEF1 lymphoid enhancer-binding factor 1 [ Homo sapiens ]
• Official Symbol: LEF1
• Synonyms: LEF1; lymphoid enhancer-binding factor 1; TCF1ALPHA; TCF7L3; TCF10; TCF1-alpha; T cell-specific transcription factor 1-alpha; LEF-1; FLJ46390; DKFZp586H0919
• Gene ID: 51176
• mRNA Refseq: NM_001130713
• Protein Refseq: NP_001124185
• UniProt ID: Q9UJU2