Recombinant Human LEP Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LEP-3523H
Product Overview : LEP MS Standard C13 and N15-labeled recombinant protein (NP_000221) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein that is secreted by white adipocytes into the circulation and plays a major role in the regulation of energy homeostasis. Circulating leptin binds to the leptin receptor in the brain, which activates downstream signaling pathways that inhibit feeding and promote energy expenditure. This protein also has several endocrine functions, and is involved in the regulation of immune and inflammatory responses, hematopoiesis, angiogenesis, reproduction, bone formation and wound healing. Mutations in this gene and its regulatory regions cause severe obesity and morbid obesity with hypogonadism in human patients. A mutation in this gene has also been linked to type 2 diabetes mellitus development.
Molecular Mass : 18.6 kDa
AA Sequence : MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGCTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LEP leptin [ Homo sapiens (human) ]
Official Symbol LEP
Synonyms LEP; leptin; leptin (murine obesity homolog), leptin (obesity homolog, mouse), OB, OBS; obese protein; obesity factor; obese, mouse, homolog of; leptin (murine obesity homolog); leptin (obesity homolog, mouse); OB; OBS; FLJ94114;
Gene ID 3952
mRNA Refseq NM_000230
Protein Refseq NP_000221
MIM 164160
UniProt ID P41159

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LEP Products

Required fields are marked with *

My Review for All LEP Products

Required fields are marked with *

0
cart-icon
0
compare icon