Recombinant Mouse Lep Protein
Cat.No. : | Lep-202M |
Product Overview : | Recombinant Mouse Lep Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Leptin is a hormone that is produced by adipose tissue and plays critical roles in the physiologic regulation of body weight. Leptin acts through the leptin receptor (LEPR) to regulate adipose mass by inhibiting hunger and balancing energy usage. Leptin mutations cause severe hereditary obesity and hypogonadism in rodents and humans. Leptin also has thermogenic actions, regulates enzymes of fatty acid oxidation, and is involved in hematopoiesis, angiogenesis, wound healing, inflammation, and immune responses. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Monomer, 16.1 kDa (147 aa) |
AA Sequence : | MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Lep leptin [ Mus musculus (house mouse) ] |
Official Symbol | Lep |
Synonyms | LEP; leptin; obesity factor; ob; obese; |
Gene ID | 16846 |
mRNA Refseq | NM_008493 |
Protein Refseq | NP_032519 |
UniProt ID | Q544U0 |
◆ Recombinant Proteins | ||
LEP-189H | Recombinant Human LEP protein | +Inquiry |
LEP-202H | Recombinant Human LEP, None tagged | +Inquiry |
LEP-81H | Active Recombinant Human Leptin | +Inquiry |
Lep-202M | Recombinant Mouse Lep Protein | +Inquiry |
LEP-203R | Recombinant Rat LEP Protein | +Inquiry |
◆ Native Proteins | ||
LEP-27641TH | Native Human LEP | +Inquiry |
◆ Cell & Tissue Lysates | ||
LEP-4773HCL | Recombinant Human LEP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lep Products
Required fields are marked with *
My Review for All Lep Products
Required fields are marked with *
0
Inquiry Basket