Recombinant Human LEPROTL1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LEPROTL1-1599H
• Product Overview: LEPROTL1 MS Standard C13 and N15-labeled recombinant protein (NP_056159) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LEPROTL1 (Leptin Receptor Overlapping Transcript Like 1) is a Protein Coding gene. Diseases associated with LEPROTL1 include Rectum Adenocarcinoma. An important paralog of this gene is LEPROT.
• Molecular Mass: 14.4 kDa
• AA Sequence: MAGIKALISLSFGGAIGLMFLMLGCALPIYNKYWPLFVLFFYILSPIPYCIARRLVDDTDAMSNACKELAIFLTTGIVVSAFGLPIVFARAHLIEWGACALVLTGNTVIFATILGFFLVFGSNDDFSWQQWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LEPROTL1 leptin receptor overlapping transcript like 1 [ Homo sapiens (human) ]
• Official Symbol: LEPROTL1
• Synonyms: LEPROTL1; leptin receptor overlapping transcript like 1; leptin receptor overlapping transcript-like 1; endospanin-2
• Gene ID: 23484
• mRNA Refseq: NM_015344
• Protein Refseq: NP_056159
• MIM: 607338
• UniProt ID: O95214