Recombinant Human LETM1

Cat.No. : LETM1-29424TH
Product Overview : Recombinant fragment corresponding to amino acids 601-708 of Human LETM1 with an N terminal proprietary tag; Predicted MWt 37.51 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 108 amino acids
Description : This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19.
Molecular Weight : 37.510kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANG MPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKD GKVNIDDLVKVIELVDKEDVHISTSQVA
Sequence Similarities : Contains 1 EF-hand domain.Contains 1 LETM1 domain.
Gene Name LETM1 leucine zipper-EF-hand containing transmembrane protein 1 [ Homo sapiens ]
Official Symbol LETM1
Synonyms LETM1; leucine zipper-EF-hand containing transmembrane protein 1; LETM1 and EF-hand domain-containing protein 1, mitochondrial; Mdm38 homolog (yeast);
Gene ID 3954
mRNA Refseq NM_012318
Protein Refseq NP_036450
MIM 604407
Uniprot ID O95202
Chromosome Location 4p16.3
Function calcium ion binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LETM1 Products

Required fields are marked with *

My Review for All LETM1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon