Recombinant Human LETM1
Cat.No. : | LETM1-29424TH |
Product Overview : | Recombinant fragment corresponding to amino acids 601-708 of Human LETM1 with an N terminal proprietary tag; Predicted MWt 37.51 kDa. |
- Specification
- Gene Information
- Related Products
Description : | This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. |
Protein length : | 108 amino acids |
Molecular Weight : | 37.510kDa inclusive of tags |
Source : | Wheat germ |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | ESKASKRLTKRVQQMIGQIDGLISQLEMDQQAGKLAPANG MPTGENVISVAELINAMKQVKHIPESKLTSLAAALDENKD GKVNIDDLVKVIELVDKEDVHISTSQVA |
Sequence Similarities : | Contains 1 EF-hand domain.Contains 1 LETM1 domain. |
Gene Name : | LETM1 leucine zipper-EF-hand containing transmembrane protein 1 [ Homo sapiens ] |
Official Symbol : | LETM1 |
Synonyms : | LETM1; leucine zipper-EF-hand containing transmembrane protein 1; LETM1 and EF-hand domain-containing protein 1, mitochondrial; Mdm38 homolog (yeast); |
Gene ID : | 3954 |
mRNA Refseq : | NM_012318 |
Protein Refseq : | NP_036450 |
MIM : | 604407 |
Uniprot ID : | O95202 |
Chromosome Location : | 4p16.3 |
Function : | calcium ion binding; protein binding; |
Products Types
◆ Recombinant Protein | ||
LETM1-5049M | Recombinant Mouse LETM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LETM1-3038R | Recombinant Rat LETM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
LETM1-1600C | Recombinant Chicken LETM1 | +Inquiry |
LETM1-3619H | Recombinant Human LETM1 protein, His-tagged | +Inquiry |
LETM1-4229Z | Recombinant Zebrafish LETM1 | +Inquiry |
◆ Lysates | ||
LETM1-982HCL | Recombinant Human LETM1 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket