Recombinant Human LGALS13 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LGALS13-6270H
Product Overview : LGALS13 MS Standard C13 and N15-labeled recombinant protein (NP_037400) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene has lysophospholipase activity. It is composed of two identical subunits which are held together by disulfide bonds. This protein has structural similarity to several members of the beta-galactoside-binding S-type lectin family.
Molecular Mass : 16.1 kDa
AA Sequence : MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCNTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LGALS13 galectin 13 [ Homo sapiens (human) ]
Official Symbol LGALS13
Synonyms LGALS13; lectin, galactoside-binding, soluble, 13; galactoside-binding soluble lectin 13; galectin 13; PLAC8; PP13; gal-13; galectin-13; placental protein 13; placental tissue protein 13; beta-galactoside-binding lectin; GAL13;
Gene ID 29124
mRNA Refseq NM_013268
Protein Refseq NP_037400
MIM 608717
UniProt ID Q9UHV8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS13 Products

Required fields are marked with *

My Review for All LGALS13 Products

Required fields are marked with *

0
cart-icon