Recombinant Human LGALS8 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LGALS8-849H |
| Product Overview : | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_963838) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Molecular Mass : | 35.7 kDa |
| AA Sequence : | MLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LGALS8 galectin 8 [ Homo sapiens (human) ] |
| Official Symbol | LGALS8 |
| Synonyms | LGALS8; lectin, galactoside-binding, soluble, 8; galectin-8; galectin 8; PCTA 1; galectin-8g; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; prostate carcinoma tumor antigen 1; Gal-8; PCTA1; PCTA-1; Po66-CBP; |
| Gene ID | 3964 |
| mRNA Refseq | NM_201544 |
| Protein Refseq | NP_963838 |
| MIM | 606099 |
| UniProt ID | O00214 |
| ◆ Recombinant Proteins | ||
| LGALS8-3226C | Active Recombinant Bovine LGALS8 protein, His-tagged | +Inquiry |
| LGALS8-428H | Recombinant Human LGALS8 Protein, His-tagged | +Inquiry |
| LGALS8-4441H | Recombinant Human LGALS8 Protein (Met2-Trp317), N-His tagged | +Inquiry |
| Lgals8-7204M | Recombinant Mouse Lectin, Galactose Binding, Soluble 8, His-tagged | +Inquiry |
| Lgals8-429M | Active Recombinant Mouse Lgals8 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGALS8-4763HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
| LGALS8-4762HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS8 Products
Required fields are marked with *
My Review for All LGALS8 Products
Required fields are marked with *



