Recombinant Human LGALS8 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LGALS8-4389H
Product Overview : LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified.
Molecular Mass : 40.2 kDa
AA Sequence : MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LGALS8 galectin 8 [ Homo sapiens (human) ]
Official Symbol LGALS8
Synonyms LGALS8; lectin, galactoside-binding, soluble, 8; galectin-8; galectin 8; PCTA 1; galectin-8g; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; prostate carcinoma tumor antigen 1; Gal-8; PCTA1; PCTA-1; Po66-CBP;
Gene ID 3964
mRNA Refseq NM_006499
Protein Refseq NP_006490
MIM 606099
UniProt ID O00214

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LGALS8 Products

Required fields are marked with *

My Review for All LGALS8 Products

Required fields are marked with *

0
cart-icon
0
compare icon