Recombinant Human LGALS8 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LGALS8-4389H |
Product Overview : | LGALS8 MS Standard C13 and N15-labeled recombinant protein (NP_006490) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a member of the galectin family. Galectins are beta-galactoside-binding animal lectins with conserved carbohydrate recognition domains. The galectins have been implicated in many essential functions including development, differentiation, cell-cell adhesion, cell-matrix interaction, growth regulation, apoptosis, and RNA splicing. This gene is widely expressed in tumoral tissues and seems to be involved in integrin-like cell interactions. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MMLSLNNLQNIIYNPVIPFVGTIPDQLDPGTLIVIRGHVPSDADRFQVDLQNGSSMKPRADVAFHFNPRFKRAGCIVCNTLINEKWGREEITYDTPFKREKSFEIVIMVLKDKFQVAVNGKHTLLYGHRIGPEKIDTLGIYGKVNIHSIGFSFSSDLQSTQASSLELTEISRENVPKSGTPQLPSNRGGDISKIAPRTVYTKSKDSTVNHTLTCTKIPPMNYVSKRLPFAARLNTPMGPGRTVVVKGEVNANAKSFNVDLLAGKSKDIALHLNPRLNIKAFVRNSFLQESWGEEERNITSFPFSPGMYFEMIIYCDVREFKVAVNGVHSLEYKHRFKELSSIDTLEINGDIHLLEVRSWTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LGALS8 galectin 8 [ Homo sapiens (human) ] |
Official Symbol | LGALS8 |
Synonyms | LGALS8; lectin, galactoside-binding, soluble, 8; galectin-8; galectin 8; PCTA 1; galectin-8g; Po66 carbohydrate binding protein; po66 carbohydrate-binding protein; prostate carcinoma tumor antigen 1; Gal-8; PCTA1; PCTA-1; Po66-CBP; |
Gene ID | 3964 |
mRNA Refseq | NM_006499 |
Protein Refseq | NP_006490 |
MIM | 606099 |
UniProt ID | O00214 |
◆ Recombinant Proteins | ||
Lgals8-3776M | Recombinant Mouse Lgals8 Protein, Myc/DDK-tagged | +Inquiry |
LGALS8-3226C | Recombinant Cattle LGALS8 protein, His-tagged | +Inquiry |
Lgals8-2553R | Recombinant Rat Lectin, Galactoside-binding, Soluble, 8 | +Inquiry |
Lgals8-7204M | Recombinant Mouse Lectin, Galactose Binding, Soluble 8, His-tagged | +Inquiry |
LGALS8-1879C | Recombinant Chicken LGALS8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS8-4763HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
LGALS8-4762HCL | Recombinant Human LGALS8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LGALS8 Products
Required fields are marked with *
My Review for All LGALS8 Products
Required fields are marked with *
0
Inquiry Basket