Recombinant Human LGALS9 protein, GST-tagged
Cat.No. : | LGALS9-032H |
Product Overview : | Recombinant Human LGALS9 protein(NP_002299)(1-323 aa), fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-323 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LGALS9 lectin, galactoside-binding, soluble, 9 [ Homo sapiens ] |
Official Symbol | LGALS9 |
Synonyms | LGALS9; lectin, galactoside-binding, soluble, 9; galectin-9; galectin 9; LGALS9A; gal-9; ecalectin; tumor antigen HOM-HD-21; urate transporter/channel protein; HUAT; MGC117375; MGC125973; MGC125974; |
Gene ID | 3965 |
mRNA Refseq | NM_002308 |
Protein Refseq | NP_002299 |
MIM | 601879 |
UniProt ID | O00182 |
◆ Recombinant Proteins | ||
LGALS9-3224M | Recombinant Mouse LGALS9 protein, His-tagged | +Inquiry |
LGALS9-208H | Active Recombinant Human LGALS9 protein | +Inquiry |
LGALS9-3146H | Recombinant Human LGALS9 Protein (Met1-Gln148), N-His tagged | +Inquiry |
LGALS9-660H | Recombinant Human LGALS9 Protein | +Inquiry |
LGALS9-471HAF488 | Recombinant Human LGALS9 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS9 Products
Required fields are marked with *
My Review for All LGALS9 Products
Required fields are marked with *
0
Inquiry Basket