Recombinant Human LGALS9 protein, His-GST-tagged
Cat.No. : | LGALS9-3170H |
Product Overview : | Recombinant Human LGALS9 protein(O00182)(1-323aa), fused to N-terminal His tag and GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-323aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 65.9 kDa |
AA Sequence : | MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | LGALS9 lectin, galactoside-binding, soluble, 9 [ Homo sapiens ] |
Official Symbol | LGALS9 |
Synonyms | LGALS9; lectin, galactoside-binding, soluble, 9; galectin-9; galectin 9; LGALS9A; gal-9; ecalectin; tumor antigen HOM-HD-21; urate transporter/channel protein; HUAT; MGC117375; MGC125973; MGC125974; |
Gene ID | 3965 |
mRNA Refseq | NM_002308 |
Protein Refseq | NP_002299 |
MIM | 601879 |
UniProt ID | O00182 |
◆ Recombinant Proteins | ||
LGALS9-660H | Recombinant Human LGALS9 Protein | +Inquiry |
LGALS9-3146H | Recombinant Human LGALS9 Protein (Met1-Gln148), N-His tagged | +Inquiry |
Lgals9-696M | Recombinant Mouse Lgals9, His-tagged | +Inquiry |
LGALS9-032H | Recombinant Human LGALS9 protein, GST-tagged | +Inquiry |
Lgals9-435R | Recombinant Rat Lgals9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LGALS9-4761HCL | Recombinant Human LGALS9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGALS9 Products
Required fields are marked with *
My Review for All LGALS9 Products
Required fields are marked with *