Recombinant Human LGI1 protein, His&Myc-tagged
| Cat.No. : | LGI1-5364H |
| Product Overview : | Recombinant Human LGI1 protein(O95970)(35-557aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in Insect cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Insect cells |
| Tag : | His&Myc |
| Protein Length : | 35-557aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Molecular Mass : | 63.9 kDa |
| AA Sequence : | KKPAKPKCPAVCTCTKDNALCENARSIPRTVPPDVISLSFVRSGFTEISEGSFLFTPSLQLLLFTSNSFDVISDDAFIGLPHLEYLFIENNNIKSISRHTFRGLKSLIHLSLANNNLQTLPKDIFKGLDSLTNVDLRGNSFNCDCKLKWLVEWLGHTNATVEDIYCEGPPEYKKRKINSLSSKDFDCIITEFAKSQDLPYQSLSIDTFSYLNDEYVVIAQPFTGKCIFLEWDHVEKTFRNYDNITGTSTVVCKPIVIETQLYVIVAQLFGGSHIYKRDSFANKFIKIQDIEILKIRKPNDIETFKIENNWYFVVADSSKAGFTTIYKWNGNGFYSHQSLHAWYRDTDVEYLEIVRTPQTLRTPHLILSSSSQRPVIYQWNKATQLFTNQTDIPNMEDVYAVKHFSVKGDVYICLTRFIGDSKVMKWGGSSFQDIQRMPSRGSMVFQPLQINNYQYAILGSDYSFTQVYNWDAEKAKFVKFQELNVQAPRSFTHVSINKRNFLFASSFKGNTQIYKHVIVDLSA |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Official Symbol | LGI1 |
| Synonyms | LGI1; leucine-rich, glioma inactivated 1; epilepsy, partial , EPT; leucine-rich glioma-inactivated protein 1; EPITEMPIN; ETL1; IB1099; epitempin-1; EPT; ADLTE; ADPAEF; |
| Gene ID | 9211 |
| mRNA Refseq | NM_005097 |
| Protein Refseq | NP_005088 |
| MIM | 604619 |
| UniProt ID | O95970 |
| ◆ Recombinant Proteins | ||
| LGI1-5363H | Recombinant Human LGI1 protein, His-PDI-tagged | +Inquiry |
| LGI1-02HFL | Recombinant Full Length Human LGI1 Protein, GST tagged | +Inquiry |
| LGI1-5059M | Recombinant Mouse LGI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LGI1-9069ME | Recombinant Mouse LGI1 Protein, His tagged | +Inquiry |
| LGI1-9069M | Recombinant Mouse LGI1 Protein, His tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LGI1-4759HCL | Recombinant Human LGI1 293 Cell Lysate | +Inquiry |
| LGI1-365HKCL | Human LGI1 Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGI1 Products
Required fields are marked with *
My Review for All LGI1 Products
Required fields are marked with *
