Recombinant Human LGR5 protein, His-tagged
Cat.No. : | LGR5-2914H |
Product Overview : | Recombinant Human LGR5 protein(373-536 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 373-536 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | CQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKAL |
Gene Name | LGR5 leucine-rich repeat containing G protein-coupled receptor 5 [ Homo sapiens ] |
Official Symbol | LGR5 |
Synonyms | LGR5; leucine-rich repeat containing G protein-coupled receptor 5; G protein coupled receptor 49 , GPR49, GPR67, leucine rich repeat containing G protein coupled receptor 5; leucine-rich repeat-containing G-protein coupled receptor 5; FEX; HG38; G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38; orphan G protein-coupled receptor HG38; leucine-rich repeat-containing G protein-coupled receptor 5; GPR49; GPR67; GRP49; MGC117008; |
Gene ID | 8549 |
mRNA Refseq | NM_003667 |
Protein Refseq | NP_003658 |
MIM | 606667 |
UniProt ID | O75473 |
◆ Recombinant Proteins | ||
ADAL-143H | Recombinant Human ADAL, His-tagged | +Inquiry |
LGR5-2914H | Recombinant Human LGR5 protein, His-tagged | +Inquiry |
ADAL-3419Z | Recombinant Zebrafish ADAL | +Inquiry |
ADAL-843HF | Recombinant Full Length Human ADAL Protein, GST-tagged | +Inquiry |
ADAL-305M | Recombinant Mouse ADAL Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ADAL-9039HCL | Recombinant Human ADAL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ADAL Products
Required fields are marked with *
My Review for All ADAL Products
Required fields are marked with *
0
Inquiry Basket