Recombinant Human LGR5 protein, His-tagged

• Cat.No.: LGR5-2914H
• Product Overview: Recombinant Human LGR5 protein(373-536 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 373-536 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Purity: 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: CQKLQKIDLRHNEIYEIKVDTFQQLLSLRSLNLAWNKIAIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKAL

Gene Information

• Gene Name: LGR5 leucine-rich repeat containing G protein-coupled receptor 5 [ Homo sapiens ]
• Official Symbol: LGR5
• Synonyms: LGR5; leucine-rich repeat containing G protein-coupled receptor 5; G protein coupled receptor 49 , GPR49, GPR67, leucine rich repeat containing G protein coupled receptor 5; leucine-rich repeat-containing G-protein coupled receptor 5; FEX; HG38; G-protein coupled receptor 49; G-protein coupled receptor 67; G-protein coupled receptor HG38; orphan G protein-coupled receptor HG38; leucine-rich repeat-containing G protein-coupled receptor 5; GPR49; GPR67; GRP49; MGC117008
• Gene ID: 8549
• mRNA Refseq: NM_003667
• Protein Refseq: NP_003658
• MIM: 606667
• UniProt ID: O75473