Recombinant Human LGSN protein, His-tagged
Cat.No. : | LGSN-560H |
Product Overview : | Recombinant Human LGSN protein(161-509 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 161-509 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
AASequence : | WADRTARVICDTFTVTGEPLLTSPRYIAKRQLSHLQASGFSLLSAFIYDFCIFGVPEILNSKIISFPALTFLNNHDQPFMQELVDGLYHTGANVESFSSSTRPGQMEISFLPEFGISSADNAFTLRTGVKEVARKYNYIASFFIETGFCDSGILSHSLWDVDRKKNMFCSTSGTEQLTITGKKWLAGLLKHSAALSCLMAPSVSCRKRYSKDRKDLKKSVPTTWGYNDNSCIFNIKCHGEKGTRIENKLGSATANPYLVLAATVAAGLDGLHSSNEVLAGPDESTDFYQVEPSEIPLKLEDALVALEEDQCLRQALGETFIRYFVAMKKYELENEEIAAERNKFLEYFI |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | LGSN lengsin, lens protein with glutamine synthetase domain [ Homo sapiens ] |
Official Symbol | LGSN |
Synonyms | LGS; GLULD1 |
Gene ID | 51557 |
mRNA Refseq | NM_016571.2 |
Protein Refseq | NP_057655.2 |
MIM | 611470 |
UniProt ID | Q5TDP6 |
◆ Recombinant Proteins | ||
LGSN-9077M | Recombinant Mouse LGSN Protein | +Inquiry |
LGSN-5066M | Recombinant Mouse LGSN Protein, His (Fc)-Avi-tagged | +Inquiry |
LGSN-3397R | Recombinant Rat LGSN Protein | +Inquiry |
LGSN-1526H | Recombinant Human LGSN Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LGSN-3313C | Recombinant Chicken LGSN | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LGSN Products
Required fields are marked with *
My Review for All LGSN Products
Required fields are marked with *
0
Inquiry Basket