Recombinant Human LHCGR protein, His-tagged

Cat.No. : LHCGR-023H
Product Overview : Recombinant Human LHCGR protein(NP_000224)(49-219 aa), fused to His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 49-219 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AA Sequence : AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles.
Concentration : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name LHCGR luteinizing hormone/choriogonadotropin receptor [ Homo sapiens ]
Official Symbol LHCGR
Synonyms LHCGR; luteinizing hormone/choriogonadotropin receptor; HHG, hypergonadotropic hypogonadism; lutropin-choriogonadotropic hormone receptor; LCGR; LGR2; LHR; ULG5; hypergonadotropic hypogonadism; lutropin/choriogonadotropin receptor; HHG; LHRHR; LSH-R; LH/CGR; LH/CG-R; FLJ41504;
Gene ID 3973
mRNA Refseq NM_000233
Protein Refseq NP_000224
MIM 152790
UniProt ID P22888

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LHCGR Products

Required fields are marked with *

My Review for All LHCGR Products

Required fields are marked with *

0

Inquiry Basket

cartIcon