Recombinant Human LHCGR protein, His-tagged
Cat.No. : | LHCGR-023H |
Product Overview : | Recombinant Human LHCGR protein(NP_000224)(49-219 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 49-219 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | AGLTRLSLAYLPVKVIPSQAFRGLNEVIKIEISQIDSLERIEANAFDNLLNLSEILIQNTKNLRYIEPGAFINLPRLKYLSICNTGIRKFPDVTKVFSSESNFILEICDNLHITTIPGNAFQGMNNESVTLKLYGNGFEEVQSHAFNGTTLTSLELKENVHLEKMHNGAFR |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Aliquot and store at -20°C to -80°C for up to 6 months. Avoid repeat freeze-thaw cycles. |
Concentration : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | LHCGR luteinizing hormone/choriogonadotropin receptor [ Homo sapiens ] |
Official Symbol | LHCGR |
Synonyms | LHCGR; luteinizing hormone/choriogonadotropin receptor; HHG, hypergonadotropic hypogonadism; lutropin-choriogonadotropic hormone receptor; LCGR; LGR2; LHR; ULG5; hypergonadotropic hypogonadism; lutropin/choriogonadotropin receptor; HHG; LHRHR; LSH-R; LH/CGR; LH/CG-R; FLJ41504; |
Gene ID | 3973 |
mRNA Refseq | NM_000233 |
Protein Refseq | NP_000224 |
MIM | 152790 |
UniProt ID | P22888 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHCGR Products
Required fields are marked with *
My Review for All LHCGR Products
Required fields are marked with *