Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LHFPL2-2574H |
Product Overview : | LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. |
Molecular Mass : | 24.3 kDa |
AA Sequence : | MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LHFPL2 lipoma HMGIC fusion partner-like 2 [ Homo sapiens (human) ] |
Official Symbol | LHFPL2 |
Synonyms | LHFPL2; lipoma HMGIC fusion partner-like 2; lipoma HMGIC fusion partner-like 2 protein; KIAA0206; LHFP-like protein 2; DKFZp781E0375; |
Gene ID | 10184 |
mRNA Refseq | NM_005779 |
Protein Refseq | NP_005770 |
MIM | 609718 |
UniProt ID | Q6ZUX7 |
◆ Recombinant Proteins | ||
LHFPL2-9081M | Recombinant Mouse LHFPL2 Protein | +Inquiry |
LHFPL2-524H | Recombinant Human LHFPL2 Protein, MYC/DDK-tagged | +Inquiry |
LHFPL2-2574H | Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Lhfpl2-3780M | Recombinant Mouse Lhfpl2 Protein, Myc/DDK-tagged | +Inquiry |
RFL20482HF | Recombinant Full Length Human Lipoma Hmgic Fusion Partner-Like 2 Protein(Lhfpl2) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LHFPL2 Products
Required fields are marked with *
My Review for All LHFPL2 Products
Required fields are marked with *
0
Inquiry Basket