Recombinant Human LHFPL2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | LHFPL2-2574H |
| Product Overview : | LHFPL2 MS Standard C13 and N15-labeled recombinant protein (NP_005770) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene is a member of the lipoma HMGIC fusion partner (LHFP) gene family, which is a subset of the superfamily of tetraspan transmembrane protein encoding genes. Mutations in one LHFP-like gene result in deafness in humans and mice, and a second LHFP-like gene is fused to a high-mobility group gene in a translocation-associated lipoma. Alternatively spliced transcript variants have been found, but their biological validity has not been determined. |
| Molecular Mass : | 24.3 kDa |
| AA Sequence : | MCHVIVTCRSMLWTLLSIVVAFAELIAFMSADWLIGKARSRGGVEPAGPGGGSPEPYHPTLGIYARCIRNPGVQHFQRDTLCGPYAESFGEIASGFWQATAIFLAVGIFILCMVALVSVFTMCVQSIMKKSIFNVCGLLQGIAGLFLILGLILYPAGWGCQKAIDYCGHYASAYKPGDCSLGWAFYTAIGGTVLTFICAVFSAQAEIATSSDKVQEEIEEGKNLICLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | LHFPL2 lipoma HMGIC fusion partner-like 2 [ Homo sapiens (human) ] |
| Official Symbol | LHFPL2 |
| Synonyms | LHFPL2; lipoma HMGIC fusion partner-like 2; lipoma HMGIC fusion partner-like 2 protein; KIAA0206; LHFP-like protein 2; DKFZp781E0375; |
| Gene ID | 10184 |
| mRNA Refseq | NM_005779 |
| Protein Refseq | NP_005770 |
| MIM | 609718 |
| UniProt ID | Q6ZUX7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHFPL2 Products
Required fields are marked with *
My Review for All LHFPL2 Products
Required fields are marked with *



