Recombinant Human LHX1 protein, GST-tagged
| Cat.No. : | LHX1-3669H |
| Product Overview : | Recombinant Human LHX1 protein(115-180 aa), fused to GST tag, was expressed in E. coli. |
| Availability | January 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 115-180 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | KEDYLSNSSVAKENSLHSATTGSDPSLSPDSQDPSQDDAKDSESANVSDKEAGSNENDDQNLGAKR |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | LHX1 LIM homeobox 1 [ Homo sapiens ] |
| Official Symbol | LHX1 |
| Synonyms | LHX1; LIM homeobox 1; LIM/homeobox protein Lhx1; LIM 1; LIM1; LIM homeobox protein 1; homeobox protein Lim-1; LIM-1; MGC126723; MGC138141; |
| Gene ID | 3975 |
| mRNA Refseq | NM_005568 |
| Protein Refseq | NP_005559 |
| MIM | 601999 |
| UniProt ID | P48742 |
| ◆ Recombinant Proteins | ||
| LHX1-9085M | Recombinant Mouse LHX1 Protein | +Inquiry |
| LHX1-3669H | Recombinant Human LHX1 protein, GST-tagged | +Inquiry |
| LHX1-3060R | Recombinant Rat LHX1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| LHX1-568H | Recombinant Human LHX1, His-tagged | +Inquiry |
| LHX1-3404R | Recombinant Rat LHX1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LHX1-4752HCL | Recombinant Human LHX1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LHX1 Products
Required fields are marked with *
My Review for All LHX1 Products
Required fields are marked with *
