Recombinant Human LILRB2, His-tagged
Cat.No. : | LILRB2-115H |
Product Overview : | Recombinant Human Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2/LILRB2 produced by transfected human cells is a secreted protein with sequence (Gln22-His458) of Human LILRB2 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 22-458 a.a. |
Description : | Members of the immunoglobulin-like transcript (ILT) family are activating and inhibitory immunoreceptors whose genes are located same locus that encodes killer cell Ig-like receptors (KIR). Leukocyte Immunoglobulin-Like Receptor Subfamily B Member 2 (LIR-2) is a type I transmembrane protein. LIR-2 is expressed primarily on monocytes and dendritic cells (DC). Human LIR-2 is produced as a 598 amino acino acid precursor including a 21 aa signal sequence, a 440 aa extracellular domain (ECD), a 21 aa transmenbrane segment, and a 116 aa cytoplasmic domain. LIR-2 binds to Classical MHCI proteins. Ligation of LIR-2 incluces Tyr phosphorylation within its cytoplasmic ITIMs, a requirement for association with SHP-1. LIR-2 mediates tolerogenic DC-induced CD4+ T cell energy in vitro and in vivo. |
Form : | Lyophilized from a 0.2 μM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
AA Sequence : | QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIP SITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFG GFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLEL LVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANF TLGPVSRSYGGQYRCYGAYNLSSEWSAPSDPLDILITGQIHGTPFISVQPGPTVASGENVTLLCQ SWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPS EPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4-7°C for 2-7 days.Aliquots of reconstituted samples are stable at |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Gene Name | LILRB2 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 [ Homo sapiens ] |
Official Symbol | LILRB2 |
Synonyms | LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transcript 4; CD85 antigen-like family member D; leukocyte immunoglobulin-like receptor 2; monocyte/macrophage immunoglobulin-like receptor 10; leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform; eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; CD85D; LIR-2; LILRA6; MIR-10; |
Gene ID | 10288 |
mRNA Refseq | NM_001080978 |
Protein Refseq | NP_001074447 |
MIM | 604815 |
UniProt ID | Q8N423 |
Chromosome Location | 19q13.4 |
Pathway | Adaptive Immune System, organism-specific biosystem; Immune System, organism-specific biosystem; Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell, organism-specific biosystem; Osteoclast differentiation, organism-specific biosystem; Osteoclast differentiation, conserved biosystem; |
Function | MHC class I protein binding; MHC class I protein binding; MHC class Ib protein binding; cell adhesion molecule binding; eukaryotic cell surface binding; inhibitory MHC class I receptor activity; inhibitory MHC class I receptor activity; protein binding; protein phosphatase 1 binding; receptor activity; |
◆ Recombinant Proteins | ||
LILRB2-01H | Recombinant Human LILRB2 Protein, His-tagged | +Inquiry |
LILRB2-4474H | Recombinant Human LILRB2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LILRB2-115H | Recombinant Human LILRB2, His-tagged | +Inquiry |
LILRB2-3883H | Recombinant Human LILRB2 Protein (Gln22-His458), C-His tagged | +Inquiry |
LILRB2-232H | Recombinant Human LILRB2 Protein (ECD), His-tagged(C-ter) | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB2-1059HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
LILRB2-1211HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB2 Products
Required fields are marked with *
My Review for All LILRB2 Products
Required fields are marked with *