Recombinant Human LILRB2 protein, His&Myc-tagged
Cat.No. : | LILRB2-5975H |
Product Overview : | Recombinant Human LILRB2 protein(Q8N423)(22-460aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 22-460a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 55.1 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVMAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPGPEDQPLTPTGSDPQSGLGRHLGV |
Gene Name | LILRB2 leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2 [ Homo sapiens ] |
Official Symbol | LILRB2 |
Synonyms | LILRB2; leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 2; leukocyte immunoglobulin-like receptor subfamily B member 2; CD85d; ILT4; LIR 2; LIR2; MIR 10; MIR10; ILT-4; Ig-like transcript 4; immunoglobulin-like transcript 4; CD85 antigen-like family member D; leukocyte immunoglobulin-like receptor 2; monocyte/macrophage immunoglobulin-like receptor 10; leukocyte immunoglobulin-like receptor subfamily B member 2 soluble isoform; eukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 6; CD85D; LIR-2; LILRA6; MIR-10; |
Gene ID | 10288 |
mRNA Refseq | NM_001080978 |
Protein Refseq | NP_001074447 |
MIM | 604815 |
UniProt ID | Q8N423 |
◆ Recombinant Proteins | ||
LILRB2-5674C | Recombinant Cynomolgus LILRB2 protein, His-tagged | +Inquiry |
LILRB2-423H | Recombinant Human LILRB2 protein, His-Avi-tagged | +Inquiry |
LILRB2-30H | Recombinant Human LILRB2 protein, His-Avi-tagged, Biotinylated | +Inquiry |
LILRB2-202H | Recombinant Human LILRB2 protein, His-Avi-tagged | +Inquiry |
LILRB2-8639HB | Recombinant Human LILRB2 protein, His-tagged, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
LILRB2-1211HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
LILRB2-1059HCL | Recombinant Human LILRB2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LILRB2 Products
Required fields are marked with *
My Review for All LILRB2 Products
Required fields are marked with *