Recombinant Human LIN52 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : LIN52-4252H
Product Overview : LIN52 MS Standard C13 and N15-labeled recombinant protein (NP_001019845) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : LIN52 (Lin-52 DREAM MuvB Core Complex Component) is a Protein Coding gene. Among its related pathways are Cell cycle Cell cycle (generic schema) and Regulation of PLK1 Activity at G2/M Transition.
Molecular Mass : 13 kDa
AA Sequence : MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name LIN52 lin-52 DREAM MuvB core complex component [ Homo sapiens (human) ]
Official Symbol LIN52
Synonyms LIN52; lin-52 DREAM MuvB core complex component; C14orf46; c14_5549; protein lin-52 homolog; lin-52 homolog
Gene ID 91750
mRNA Refseq NM_001024674
Protein Refseq NP_001019845
UniProt ID Q52LA3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIN52 Products

Required fields are marked with *

My Review for All LIN52 Products

Required fields are marked with *

0
cart-icon