Recombinant Human LIN52 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: LIN52-4252H
• Product Overview: LIN52 MS Standard C13 and N15-labeled recombinant protein (NP_001019845) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: LIN52 (Lin-52 DREAM MuvB Core Complex Component) is a Protein Coding gene. Among its related pathways are Cell cycle Cell cycle (generic schema) and Regulation of PLK1 Activity at G2/M Transition.
• Molecular Mass: 13 kDa
• AA Sequence: MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: LIN52 lin-52 DREAM MuvB core complex component [ Homo sapiens (human) ]
• Official Symbol: LIN52
• Synonyms: LIN52; lin-52 DREAM MuvB core complex component; C14orf46; c14_5549; protein lin-52 homolog; lin-52 homolog
• Gene ID: 91750
• mRNA Refseq: NM_001024674
• Protein Refseq: NP_001019845
• UniProt ID: Q52LA3