Recombinant Human LIN52 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | LIN52-4252H |
Product Overview : | LIN52 MS Standard C13 and N15-labeled recombinant protein (NP_001019845) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | LIN52 (Lin-52 DREAM MuvB Core Complex Component) is a Protein Coding gene. Among its related pathways are Cell cycle Cell cycle (generic schema) and Regulation of PLK1 Activity at G2/M Transition. |
Molecular Mass : | 13 kDa |
AA Sequence : | MGWKMASPTDGTDLEASLLSFEKLDRASPDLWPEQLPGVAEFAASFKSPITSSPPKWMAEIERDDIDMLKELGSLTTANLMEKVRGLQNLAYQLGLDESREMTRGKFLNILEKPKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | LIN52 lin-52 DREAM MuvB core complex component [ Homo sapiens (human) ] |
Official Symbol | LIN52 |
Synonyms | LIN52; lin-52 DREAM MuvB core complex component; C14orf46; c14_5549; protein lin-52 homolog; lin-52 homolog |
Gene ID | 91750 |
mRNA Refseq | NM_001024674 |
Protein Refseq | NP_001019845 |
UniProt ID | Q52LA3 |
◆ Recombinant Proteins | ||
Lin52-3786M | Recombinant Mouse Lin52 Protein, Myc/DDK-tagged | +Inquiry |
LIN52-3367H | Recombinant Human LIN52 Protein, His (Fc)-Avi-tagged | +Inquiry |
LIN52-4252H | Recombinant Human LIN52 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
LIN52-4868Z | Recombinant Zebrafish LIN52 | +Inquiry |
LIN52-1802C | Recombinant Chicken LIN52 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIN52-4731HCL | Recombinant Human LIN52 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIN52 Products
Required fields are marked with *
My Review for All LIN52 Products
Required fields are marked with *