Recombinant Human LINC00173 Protein, GST-tagged

Cat.No. : LINC00173-4340H
Product Overview : Human FLJ42957 full-length ORF ( NP_997319.1, 1 a.a. - 143 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : LINC00173 (Long Intergenic Non-Protein Coding RNA 173) is an RNA Gene, and is affiliated with the non-coding RNA class.
Molecular Mass : 42.8 kDa
AA Sequence : MSFSPYSTMITVCVCFNSRVQLTVPSFTAWLRSRYSKALFMVLRRAAQEKDKGVCQGWHCVKKWACKGRIPGQPLQPQPLGPYLRSLSQHPATQTPRPQARASSRYLELHRSQNRGGSEFKFWFCYCLIACCRDSISSSGKWE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LINC00173 long intergenic non-protein coding RNA 173 [ Homo sapiens (human) ]
Official Symbol LINC00173
Synonyms LINC00173; long intergenic non-protein coding RNA 173; NCRNA00173; FLJ42957; MGC148154; MGC148155
Gene ID 100287569
UniProt ID Q6ZV60

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LINC00173 Products

Required fields are marked with *

My Review for All LINC00173 Products

Required fields are marked with *

0
cart-icon