Recombinant Human LIPF Protein, GST-tagged
Cat.No. : | LIPF-05H |
Product Overview : | Human LIPF partial ORF (299 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 299-398 |
Description : | This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LIPF lipase F, gastric type [ Homo sapiens (human) ] |
Official Symbol | LIPF |
Synonyms | LIPF; lipase F, gastric type; GL; HGL; HLAL; gastric triacylglycerol lipase; gastric lipase; lipase, gastric; EC 3.1.1.3 |
Gene ID | 8513 |
mRNA Refseq | NM_004190 |
Protein Refseq | NP_004181 |
MIM | 601980 |
UniProt ID | P07098 |
◆ Recombinant Proteins | ||
LIPF-06H | Recombinant Human LIPF Protein, GST-tagged | +Inquiry |
LIPE-8393H | Recombinant Human LIPF Protein, Myc/DDK-tagged | +Inquiry |
LIPF-7939H | Recombinant Human LIPF protein, His & GST-tagged | +Inquiry |
LIPF-5220H | Recombinant Human LIPF Protein (Leu20-Lys398), N-GST tagged | +Inquiry |
LIPF-101H | Recombinant Human LIPF, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
LIPF-001HCL | Recombinant Human LIPF cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LIPF Products
Required fields are marked with *
My Review for All LIPF Products
Required fields are marked with *
0
Inquiry Basket