Recombinant Human LIPF Protein, GST-tagged

Cat.No. : LIPF-05H
Product Overview : Human LIPF partial ORF (299 a.a. - 398 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 299-398
Description : This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 36.74 kDa
AA Sequence : KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name LIPF lipase F, gastric type [ Homo sapiens (human) ]
Official Symbol LIPF
Synonyms LIPF; lipase F, gastric type; GL; HGL; HLAL; gastric triacylglycerol lipase; gastric lipase; lipase, gastric; EC 3.1.1.3
Gene ID 8513
mRNA Refseq NM_004190
Protein Refseq NP_004181
MIM 601980
UniProt ID P07098

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIPF Products

Required fields are marked with *

My Review for All LIPF Products

Required fields are marked with *

0

Inquiry Basket

cartIcon