Recombinant Human LIPG Protein, His-tagged

Cat.No. : LIPG-16H
Product Overview : LIPG Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 343 amino acids (21-340) and having a molecular mass of 38 kDa. LIPG is fused to a 23 amino acid His-tag at N-terminus and purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 21-340
Description : The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.
Form : Sterile Filtered clear solution.
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRA.
Purity : Greater than 85% as determined by SDS-PAGE.
Usage : Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Stability : Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
Concentration : 1 mg/mL
Storage Buffer : 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea.
Shipping : Ice Packs
Gene Name LIPG lipase G, endothelial type [ Homo sapiens (human) ]
Official Symbol LIPG
Synonyms LIPG; lipase G, endothelial type; EL; EDL; PRO719; endothelial lipase; endothelial cell-derived lipase; lipase, endothelial; lipoprotein lipase H; phospholipase A1; EC 3.1.1.3; EC 3.1.1.32
Gene ID 9388
mRNA Refseq NM_006033
Protein Refseq NP_006024
MIM 603684
UniProt ID Q9Y5X9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LIPG Products

Required fields are marked with *

My Review for All LIPG Products

Required fields are marked with *

0

Inquiry Basket

cartIcon