Recombinant Human LIPG Protein, His-tagged

• Cat.No.: LIPG-16H
• Product Overview: LIPG Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 343 amino acids (21-340) and having a molecular mass of 38 kDa. LIPG is fused to a 23 amino acid His-tag at N-terminus and purified by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 21-340
• Description: The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family.
• Form: Sterile Filtered clear solution.
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRA.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Usage: Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
• Stability: Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles.
• Concentration: 1 mg/mL
• Storage Buffer: 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea.
• Shipping: Ice Packs

Gene Information

• Gene Name: LIPG lipase G, endothelial type [ Homo sapiens (human) ]
• Official Symbol: LIPG
• Synonyms: LIPG; lipase G, endothelial type; EL; EDL; PRO719; endothelial lipase; endothelial cell-derived lipase; lipase, endothelial; lipoprotein lipase H; phospholipase A1; EC 3.1.1.3; EC 3.1.1.32
• Gene ID: 9388
• mRNA Refseq: NM_006033
• Protein Refseq: NP_006024
• MIM: 603684
• UniProt ID: Q9Y5X9