Recombinant Human LIPG Protein, His-tagged
| Cat.No. : | LIPG-16H |
| Product Overview : | LIPG Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 343 amino acids (21-340) and having a molecular mass of 38 kDa. LIPG is fused to a 23 amino acid His-tag at N-terminus and purified by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 21-340 |
| Description : | The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which provides substrate specificity for enzymes of the TG lipase family. |
| Form : | Sterile Filtered clear solution. |
| AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLEDCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLDWLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRSFGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDSNRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRA. |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Usage : | Our products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals. |
| Stability : | Store at 4 centigrade if entire vial will be used within 2-4 weeks. Store, frozen at -20 centigrade for longer periods of time. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid multiple freeze-thaw cycles. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | 20mM Tris-HCl buffer (pH 8.0), 10% glycerol and 0.4M Urea. |
| Shipping : | Ice Packs |
| Gene Name | LIPG lipase G, endothelial type [ Homo sapiens (human) ] |
| Official Symbol | LIPG |
| Synonyms | LIPG; lipase G, endothelial type; EL; EDL; PRO719; endothelial lipase; endothelial cell-derived lipase; lipase, endothelial; lipoprotein lipase H; phospholipase A1; EC 3.1.1.3; EC 3.1.1.32 |
| Gene ID | 9388 |
| mRNA Refseq | NM_006033 |
| Protein Refseq | NP_006024 |
| MIM | 603684 |
| UniProt ID | Q9Y5X9 |
| ◆ Recombinant Proteins | ||
| Lipg-1323M | Recombinant Mouse Lipg Protein, MYC/DDK-tagged | +Inquiry |
| LIPG-5328H | Recombinant Human LIPG Protein (Ala175-Ile412), His tagged | +Inquiry |
| LIPG-16H | Recombinant Human LIPG Protein, His-tagged | +Inquiry |
| LIPG-045H | Recombinant Human LIPG Protein, His-tagged | +Inquiry |
| LIPG-183HFL | Recombinant Full Length Human LIPG Protein, C-Flag-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| LIPG-4724HCL | Recombinant Human LIPG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All LIPG Products
Required fields are marked with *
My Review for All LIPG Products
Required fields are marked with *
